DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr21

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:302 Identity:91/302 - (30%)
Similarity:126/302 - (41%) Gaps:78/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDP 280
            ||:|:   .|||.  |:.|.|.:  ...||||:..|.:|||.|:|.  ..:.||||...||:.|.
  Fly    50 GPYFD---TSATK--NVTSLVGI--TGHLNCRIKNLGNKTVSWIRH--RDLHLLTVSESTYTSDQ 105

  Fly   281 RI-RVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRY 344
            |. .:..:...:|.|.|...|..|:|:|.|||||.||..:|...:|:||...|:...|     .|
  Fly   106 RFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPE-----IY 165

  Fly   345 YKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDL 409
            ...||||:|.|             ::|.......:||  .|....|:|.                
  Fly   166 IDLGSTVNLTC-------------VIKHLPDPPISVQ--WNHNNQEINY---------------- 199

  Fly   410 EKYFTKFITWAKDEEPLQGMTNRRLSV----SDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIV 470
                         :.|..|     :||    .|: .||.:.|..|.::|||.|:|......:..|
  Fly   200 -------------DSPRGG-----VSVITEKGDI-TTSYLLIQRASIADSGQYTCLPSNANSKSV 245

  Fly   471 QVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFTCL 512
            .|.:|.|:.|||||.         |..::..||.|.||..||
  Fly   246 NVHILKGDHPAAVQK---------SHLLVSELLSLCFLQICL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 33/83 (40%)
Ig <258..326 CDD:299845 25/68 (37%)
IGc2 <417..461 CDD:197706 13/47 (28%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 33/79 (42%)
IG_like 71..140 CDD:214653 29/70 (41%)
IG_like 162..249 CDD:214653 30/141 (21%)
IGc2 169..242 CDD:197706 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.