DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Kirrel3

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:547 Identity:106/547 - (19%)
Similarity:174/547 - (31%) Gaps:209/547 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IALVIGSQVQVLYTTSVETKSPSAS-EQSRNGE-------NRSLLFDDYNKTKSTLSTADYLSAT 94
            |:|..|..:.:  |...:...|:|| ...|.||       :::||.|  .|.:|.:||       
Mouse   158 ISLRAGDPLNL--TCHADNAKPAASIIWLRKGEVINGATYSKTLLRD--GKRESIVST------- 211

  Fly    95 RATLYAFSSQDQDEDHSQMPIEASNAPHSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQ 159
                 .|.|....|:...:...|:|                ...||..|.|              
Mouse   212 -----LFISPGDVENGQSIVCRATN----------------KAIPGGKETS-------------- 241

  Fly   160 LTTVTMPTTAFASLKVDRSTMKQPI-DSTRTRNHWTASGFARVTERPRSKHHH--EHHWG----- 216
             .|:.:......:|.|:    .||: :......|.:|.....||:...:|..|  :...|     
Mouse   242 -VTIDIQHPPLVNLSVE----PQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRT 301

  Fly   217 ----PFFEEPIN----SATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLL---- 269
                .:|.||::    :|....||...|.::                 ...|.|:|..|||    
Mouse   302 TVDYTYFSEPVSCEVTNALGSTNLSRTVDVY-----------------FGPRMTSEPQSLLVDLG 349

  Fly   270 --TVGNVTYSGDPRIRVKFQ-------YPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFT----T 321
              .|.:..:.|:|.:.:.:.       ..|...|.:...:.||||.|:|:...  |||..    .
Mouse   350 SDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVV--PRVGAGEREV 412

  Fly   322 NLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINE 386
            .|||..||                                       |:.||             
Mouse   413 TLTVNGPP---------------------------------------IISST------------- 425

  Fly   387 TTSELNLIGNVNQTQHKFSGQDLE-KYFTKF------ITWAKDEEPLQGMTNRRLSVSDV----W 440
                        ||||...|:..: |.|.:.      |.|:..|..|:..|:.|.:|..|    .
Mouse   426 ------------QTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETVNTEEG 478

  Fly   441 LTSRISIGDAKLSDSGN-YSCSLGRLF---TVIVQVQVLTGELPAAVQHNIGSRTEIYSLAM--- 498
            :.|.::|.:...:|... |:|:....|   |.|::::....|:.:      |:..|..|:.|   
Mouse   479 VISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKS------GAGLEAESVPMAVI 537

  Fly   499 LG----------HLLVLIFLFTCLKTE 515
            :|          .|:..|..|.|.:::
Mouse   538 IGVAVGAGVAFLVLMATIVAFCCARSQ 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 21/99 (21%)
Ig <258..326 CDD:299845 22/84 (26%)
IGc2 <417..461 CDD:197706 12/48 (25%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416 27/134 (20%)
Ig strand B 166..170 CDD:409416 0/5 (0%)
Ig strand C 180..184 CDD:409416 1/3 (33%)
Ig strand E 210..214 CDD:409416 2/15 (13%)
Ig strand F 224..229 CDD:409416 0/4 (0%)
Ig strand G 239..242 CDD:409416 2/17 (12%)
Ig <267..334 CDD:416386 14/83 (17%)
Ig strand B 267..274 CDD:409353 1/6 (17%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 1/2 (50%)
Ig strand D 298..302 CDD:409353 0/3 (0%)
Ig strand E 304..310 CDD:409353 1/5 (20%)
Ig strand G 321..334 CDD:409353 3/29 (10%)
Ig 335..416 CDD:416386 21/82 (26%)
Ig strand A' 343..347 CDD:409353 3/3 (100%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 0/5 (0%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 28/160 (18%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.