DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-delta

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:298 Identity:66/298 - (22%)
Similarity:111/298 - (37%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR 281
            |.|.:||.:.|        |.:..:|.|.|.|..|....|.|:.  .::..:||:.....|..||
  Fly    44 PRFAQPIPNVT--------VAVGRDANLPCVVEHLGGYKVAWIH--IDRQMILTIHRHVISRIPR 98

  Fly   282 IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYK 346
            ..:.:. .|.|.|.:|....:|.|.|||||:|:|.......|.|:.|| .|:| .|........:
  Fly    99 YSITYT-DNTWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPP-NILD-IESTPSSVAVR 160

  Fly   347 SGSTVDLQCQI---------------SRSFFQKERQTILKSTD-------SAND----------- 378
            ....:::.|:.               .....:|:::.::...|       |.|:           
  Fly   161 ENQNINMTCRADGFPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNG 225

  Fly   379 ---AVQKLINETTSELNLIGNVNQTQHKFSGQDL------EKYFTKFITWAKDEEPLQGMTNRRL 434
               :|.|.|........:|...||.....||.|:      |.:....|.|..:.  :..:.:::.
  Fly   226 VPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNS--VMVLPSKKY 288

  Fly   435 SVSDVWLTS-----RISIGDAKLSDSGNYSC----SLG 463
            . :|....|     :::|.:.:..|.|||.|    |||
  Fly   289 K-TDYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 26/82 (32%)
Ig <258..326 CDD:299845 20/67 (30%)
IGc2 <417..461 CDD:197706 10/52 (19%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 29/102 (28%)
Ig 145..238 CDD:416386 12/94 (13%)
Ig strand A 145..149 CDD:409353 2/4 (50%)
Ig strand A' 154..159 CDD:409353 0/4 (0%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 0/4 (0%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 0/6 (0%)
Ig strand G 230..238 CDD:409353 3/7 (43%)
Ig 242..333 CDD:416386 20/87 (23%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 0/6 (0%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/4 (25%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.