Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 298 | Identity: | 66/298 - (22%) |
---|---|---|---|
Similarity: | 111/298 - (37%) | Gaps: | 67/298 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR 281
Fly 282 IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYK 346
Fly 347 SGSTVDLQCQI---------------SRSFFQKERQTILKSTD-------SAND----------- 378
Fly 379 ---AVQKLINETTSELNLIGNVNQTQHKFSGQDL------EKYFTKFITWAKDEEPLQGMTNRRL 434
Fly 435 SVSDVWLTS-----RISIGDAKLSDSGNYSC----SLG 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 26/82 (32%) |
Ig | <258..326 | CDD:299845 | 20/67 (30%) | ||
IGc2 | <417..461 | CDD:197706 | 10/52 (19%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 29/102 (28%) |
Ig | 145..238 | CDD:416386 | 12/94 (13%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/4 (50%) | ||
Ig strand A' | 154..159 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 0/6 (0%) | ||
Ig strand G | 230..238 | CDD:409353 | 3/7 (43%) | ||
Ig | 242..333 | CDD:416386 | 20/87 (23%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 0/6 (0%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 1/4 (25%) | ||
Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 314..322 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 325..334 | CDD:409353 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |