DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and igsf9ba

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:363 Identity:69/363 - (19%)
Similarity:109/363 - (30%) Gaps:148/363 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWTASG---FARVTERPRSKH----HHE-----HH 214
            ::|:..|||.:.|...:.:::....|.||.:..:.|   ...:|...|..:    |.:     |.
Zfish   156 SITLTCTAFGNPKPVVTWLREGDQLTSTRKYTVSDGSLTVQAITREDRGAYSCRAHSDQGEALHT 220

  Fly   215 WGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRV----GMLKDKTVMWVRRTAEKVSLLTVGNVT 275
            .....:.|....|..:|:  .|::...|...|:.    |.|   |..|....         .||.
Zfish   221 TRLLVQGPPYIVTPPENI--TVNISQNAQFTCQAEAYPGNL---TYTWYWEE---------DNVY 271

  Fly   276 YSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVST---------------HPPRVFTTNLTV 325
            :..|.::||:......  |:|...:.||||.|.|..|.               :|.||      |
Zfish   272 FKNDLKLRVRIFIDGT--LIIYRVKPEDAGKYTCSPSNSLGISPSASAYLTVQYPARV------V 328

  Fly   326 LEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSE 390
            ..||:                             .:..::...|::....||..|       || 
Zfish   329 NMPPV-----------------------------IYVPRKLSGIIRCPVDANPPV-------TS- 356

  Fly   391 LNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQ--------GMTNRRLSVSDVWLTSRISI 447
                                      :.|.||..||:        .||:..:.|::|        
Zfish   357 --------------------------VRWEKDGYPLRIEKYPGWSQMTDGSIRVAEV-------- 387

  Fly   448 GDAKLSDS-GNYSCSLGRLFTVIVQVQVL--TGELPAA 482
                ..|| |.|:|         |...||  .|:.|.|
Zfish   388 ----TEDSLGTYTC---------VPYNVLGTMGQSPPA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 23/101 (23%)
Ig <258..326 CDD:299845 18/82 (22%)
IGc2 <417..461 CDD:197706 13/52 (25%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652
I-set 139..225 CDD:254352 13/68 (19%)
I-set 229..321 CDD:333254 23/107 (21%)
Ig 345..415 CDD:325142 25/123 (20%)
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.