DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and KIRREL1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:334 Identity:67/334 - (20%)
Similarity:112/334 - (33%) Gaps:127/334 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LNCRVGMLKD-KTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVY 307
            |.||....|. .|::|.|...::...:....:...|.....|.       :||||||..:...|:
Human   141 LTCRAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRETTVS-------QLLINPTDLDIGRVF 198

  Fly   308 MCQVST----------------HPPRVFTTNLTVLEPPLRIIDEHERDV------------GDRY 344
            .|:...                |||   |..|:: ||  :.:.|.||.|            |.|:
Human   199 TCRSMNEAIPSGKETSIELDVHHPP---TVTLSI-EP--QTVQEGERVVFTCQATANPEILGYRW 257

  Fly   345 YKSGSTVD------LQCQISRSFFQK----ERQTILKSTDSANDAVQKLIN------------ET 387
            .|.|..::      .:..:..|||.:    |....:.||:     |..|:|            .|
Human   258 AKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTN-----VSTLVNVHFAPRIVVDPKPT 317

  Fly   388 TSELN--------LIGNVNQTQHKFSGQDLEKYFTKFITWAKDEE----------PLQGMTNRRL 434
            |:::.        .:||...|                :||.|.:.          |...::.:.|
Human   318 TTDIGSDVTLTCVWVGNPPLT----------------LTWTKKDSNMGPRPPGSPPEAALSAQVL 366

  Fly   435 SVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELP-----------AAVQHNI- 487
            |.|:..|...::..||     |.|:|.     .::.::.|...|:|           .|||:.: 
Human   367 SNSNQLLLKSVTQADA-----GTYTCR-----AIVPRIGVAEREVPLYVNGPPIISSEAVQYAVR 421

  Fly   488 --GSRTEIY 494
              |.:.|.:
Human   422 GDGGKVECF 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 22/97 (23%)
Ig <258..326 CDD:299845 17/83 (20%)
IGc2 <417..461 CDD:197706 12/53 (23%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236 17/84 (20%)
I-set 223..304 CDD:254352 21/91 (23%)
Ig_2 227..305 CDD:290606 20/85 (24%)
Ig_2 311..405 CDD:290606 21/119 (18%)
IG_like 314..405 CDD:214653 21/116 (18%)
Ig5_KIRREL3 407..504 CDD:143306 5/24 (21%)
IG_like 416..504 CDD:214653 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.