DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and iglon5

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:262 Identity:61/262 - (23%)
Similarity:94/262 - (35%) Gaps:68/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EEPINSATSGDNLVSAVHLFTEAVLNCR-VGMLKDKTVMWVRRTAEKVSL--LTVGNVTYSGDPR 281
            |.|...:....|.....|::....:..| |.:.:||:|    ...|.|:|  |.||.    .:|.
Zfish   101 EGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSV----NEGEDVNLFCLAVGR----PEPT 157

  Fly   282 IRVK-FQYP--NNWRLL----INPTQTEDAGVYMCQVS--THPPRVFTTNLTVLEPPLRIIDEHE 337
            |..| |:|.  |....|    |...|.||   :.|..:  ..||......:||..||:      .
Zfish   158 ITWKDFKYGLLNEGEFLEITEIKRHQAED---FECITNNGVAPPDTRKVKVTVNYPPI------I 213

  Fly   338 RDVGDRYYKSGSTVDLQCQ------ISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGN 396
            .||.:...:.|.|..|:|:      .|..:::.:|:.:      .:|...|:.||.|..|.|..|
Zfish   214 TDVKNMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPV------ESDNTLKIKNEKTRSLLLFTN 272

  Fly   397 VNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMT----------------NRRLSVSDVWLTSRI 445
            |.           ||:|..:..:|.:.......:                |.|||...:|....|
Zfish   273 VT-----------EKHFGNYTCFASNRLGASNASMLLFRPGAVYGGAASLNGRLSGVGLWFCLSI 326

  Fly   446 SI 447
            |:
Zfish   327 SV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 25/94 (27%)
Ig <258..326 CDD:299845 21/78 (27%)
IGc2 <417..461 CDD:197706 8/47 (17%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 4/21 (19%)
Ig 35..123 CDD:299845 4/21 (19%)
Ig 125..>183 CDD:299845 19/65 (29%)
I-set 128..207 CDD:254352 25/89 (28%)
IG_like 217..298 CDD:214653 19/97 (20%)
ig 223..296 CDD:278476 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.