DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr12

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:369 Identity:84/369 - (22%)
Similarity:137/369 - (37%) Gaps:111/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 QLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWT-------ASGFARVTERPRSKHHHEHHWG 216
            ::..:.:||...|      :|::....|..|.|.|.       .:|.:::.....|..      .
  Fly    22 RILLLCLPTLLLA------TTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSD------S 74

  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKT------VMWVRRTAEKVSLLTVGNVT 275
            |.||:   |.....|  :.|.|...|.|.|:|..: |:.      :.|:||  ....:|:.|...
  Fly    75 PMFED---SELMAHN--TTVQLGGTAFLVCKVSGV-DRVGVNWNQISWIRR--RDWHILSSGAQL 131

  Fly   276 YSGDPRIRVKFQYP--NNWRLLINPTQTEDAGVYMCQVSTHPPRVFT--TNLTVLEPPLRIIDEH 336
            |:.|.|..: ...|  |.|.|.|...|..|.|:|.||||| |..:.:  .||.|:.|...|:.. 
  Fly   132 YTNDERFAI-LHTPGSNMWTLQIKFVQRRDHGMYECQVST-PTGIISHFVNLQVVVPEAFILGS- 193

  Fly   337 ERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQ 401
                |:.:...|||::|.|.|.:|                         .|..:           
  Fly   194 ----GELHVDMGSTINLVCIIEKS-------------------------PTPPQ----------- 218

  Fly   402 HKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWL--------TSRISIGDAKLSDSGNY 458
                          ::.|.|::..:..:.:||    |:.:        .||:.|.:.:::|||||
  Fly   219 --------------YVYWQKNDRLINYVDSRR----DITIETTPGPRTQSRLIIREPQVTDSGNY 265

  Fly   459 SCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHL 502
            :||........:.|.|..|:..||:     ||.:..|...|.|:
  Fly   266 TCSASNTEPASIYVFVSKGDNMAAI-----SRRKTSSADRLTHI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 30/92 (33%)
Ig <258..326 CDD:299845 25/71 (35%)
IGc2 <417..461 CDD:197706 13/51 (25%)
dpr12NP_652462.3 IG 86..183 CDD:214652 33/103 (32%)
Ig_3 193..271 CDD:404760 24/136 (18%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.