Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011527877.1 | Gene: | NCAM2 / 4685 | HGNCID: | 7657 | Length: | 874 | Species: | Homo sapiens |
Alignment Length: | 283 | Identity: | 63/283 - (22%) |
---|---|---|---|
Similarity: | 100/283 - (35%) | Gaps: | 96/283 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 241 EAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLL-INPTQTEDA 304
Fly 305 GVYMCQ----------------VSTHPPRVF----TTNLTV---------------LEPPL---- 330
Fly 331 --RIIDEHERDVGDRYYKSGSTVDLQ-------------CQISRSFFQKERQTILKSTDSANDAV 380
Fly 381 QKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMT--------NRRLSVS 437
Fly 438 DVWLTSRISIGDAKLSDSGNYSC 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 23/103 (22%) |
Ig | <258..326 | CDD:299845 | 19/103 (18%) | ||
IGc2 | <417..461 | CDD:197706 | 18/52 (35%) | ||
NCAM2 | XP_011527877.1 | Ig1_NCAM-2 | 46..137 | CDD:143274 | |
I-set | 47..136 | CDD:254352 | |||
I-set | 142..218 | CDD:254352 | 20/75 (27%) | ||
IGc2 | 153..214 | CDD:197706 | 20/71 (28%) | ||
Ig | 233..326 | CDD:299845 | 17/99 (17%) | ||
I-set | 240..323 | CDD:254352 | 15/87 (17%) | ||
Ig5_NCAM-2 | 325..422 | CDD:143278 | 26/93 (28%) | ||
IG_like | 333..420 | CDD:214653 | 25/85 (29%) | ||
IG_like | 438..515 | CDD:214653 | |||
IGc2 | 439..507 | CDD:197706 | |||
FN3 | 521..613 | CDD:238020 | |||
fn3 | 619..703 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |