| Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751706.1 | Gene: | cadm2 / 448238 | XenbaseID: | XB-GENE-998536 | Length: | 441 | Species: | Xenopus tropicalis |
| Alignment Length: | 152 | Identity: | 38/152 - (25%) |
|---|---|---|---|
| Similarity: | 52/152 - (34%) | Gaps: | 68/152 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 320 TTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLI 384
Fly 385 NETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGD 449
Fly 450 AKLSDSGNYSCSLGRLFTVIVQ 471 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 2/4 (50%) |
| Ig strand B | 242..246 | CDD:409433 | |||
| Ig strand C | 255..264 | CDD:409433 | |||
| Ig strand E | 292..296 | CDD:409433 | |||
| Ig strand F | 306..311 | CDD:409433 | |||
| Ig | <417..474 | CDD:472250 | 21/55 (38%) | ||
| cadm2 | XP_031751706.1 | IgV_1_Necl-3 | 34..129 | CDD:409498 | 38/152 (25%) |
| Ig strand A | 34..37 | CDD:409498 | 38/152 (25%) | ||
| FR1 | 35..53 | CDD:409498 | 8/35 (23%) | ||
| Ig strand A' | 38..44 | CDD:409498 | 3/5 (60%) | ||
| Ig strand B | 46..54 | CDD:409498 | 3/7 (43%) | ||
| CDR1 | 54..59 | CDD:409498 | 1/29 (3%) | ||
| FR2 | 60..67 | CDD:409498 | 3/7 (43%) | ||
| Ig strand C | 60..66 | CDD:409498 | 3/6 (50%) | ||
| CDR2 | 68..79 | CDD:409498 | 5/27 (19%) | ||
| Ig strand C' | 70..74 | CDD:409498 | 2/13 (15%) | ||
| Ig strand C' | 76..79 | CDD:409498 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409498 | 16/39 (41%) | ||
| Ig strand D | 84..91 | CDD:409498 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409498 | 2/5 (40%) | ||
| Ig strand F | 107..115 | CDD:409498 | 4/10 (40%) | ||
| CDR3 | 116..119 | CDD:409498 | 1/2 (50%) | ||
| Ig strand G | 119..129 | CDD:409498 | 1/2 (50%) | ||
| FR4 | 121..128 | CDD:409498 | 38/152 (25%) | ||
| IgI_2_Necl-3 | 128..231 | CDD:409467 | |||
| Ig strand A | 129..132 | CDD:409467 | |||
| Ig strand A' | 135..139 | CDD:409467 | |||
| Ig strand B | 148..158 | CDD:409467 | |||
| Ig strand C | 161..170 | CDD:409467 | |||
| Ig strand C' | 171..174 | CDD:409467 | |||
| Ig strand D | 176..183 | CDD:409467 | |||
| Ig strand E | 189..199 | CDD:409467 | |||
| Ig strand F | 207..215 | CDD:409467 | |||
| Ig strand G | 223..230 | CDD:409467 | |||
| Ig_3 | 235..308 | CDD:464046 | |||
| 4.1m | 394..412 | CDD:128590 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||