DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and cadm2

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_031751706.1 Gene:cadm2 / 448238 XenbaseID:XB-GENE-998536 Length:441 Species:Xenopus tropicalis


Alignment Length:152 Identity:38/152 - (25%)
Similarity:52/152 - (34%) Gaps:68/152 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 TTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLI 384
            |.|:||:|                    |.|::|.|::.:                         
 Frog    37 TQNVTVVE--------------------GGTINLTCRVDQ------------------------- 56

  Fly   385 NETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGD 449
            |:.|| |.......||          .||       .|::.|:  .||...|...|....|||.|
 Frog    57 NDNTS-LQWSNPAQQT----------LYF-------DDKKALR--DNRIELVRASWHELSISISD 101

  Fly   450 AKLSDSGNYSCSLGRLFTVIVQ 471
            ..|||.|.|:||   |||:.|:
 Frog   102 VSLSDEGQYTCS---LFTMPVK 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 2/4 (50%)
Ig strand B 242..246 CDD:409433
Ig strand C 255..264 CDD:409433
Ig strand E 292..296 CDD:409433
Ig strand F 306..311 CDD:409433
Ig <417..474 CDD:472250 21/55 (38%)
cadm2XP_031751706.1 IgV_1_Necl-3 34..129 CDD:409498 38/152 (25%)
Ig strand A 34..37 CDD:409498 38/152 (25%)
FR1 35..53 CDD:409498 8/35 (23%)
Ig strand A' 38..44 CDD:409498 3/5 (60%)
Ig strand B 46..54 CDD:409498 3/7 (43%)
CDR1 54..59 CDD:409498 1/29 (3%)
FR2 60..67 CDD:409498 3/7 (43%)
Ig strand C 60..66 CDD:409498 3/6 (50%)
CDR2 68..79 CDD:409498 5/27 (19%)
Ig strand C' 70..74 CDD:409498 2/13 (15%)
Ig strand C' 76..79 CDD:409498 1/2 (50%)
FR3 80..115 CDD:409498 16/39 (41%)
Ig strand D 84..91 CDD:409498 2/6 (33%)
Ig strand E 94..100 CDD:409498 2/5 (40%)
Ig strand F 107..115 CDD:409498 4/10 (40%)
CDR3 116..119 CDD:409498 1/2 (50%)
Ig strand G 119..129 CDD:409498 1/2 (50%)
FR4 121..128 CDD:409498 38/152 (25%)
IgI_2_Necl-3 128..231 CDD:409467
Ig strand A 129..132 CDD:409467
Ig strand A' 135..139 CDD:409467
Ig strand B 148..158 CDD:409467
Ig strand C 161..170 CDD:409467
Ig strand C' 171..174 CDD:409467
Ig strand D 176..183 CDD:409467
Ig strand E 189..199 CDD:409467
Ig strand F 207..215 CDD:409467
Ig strand G 223..230 CDD:409467
Ig_3 235..308 CDD:464046
4.1m 394..412 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.