DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:346 Identity:81/346 - (23%)
Similarity:134/346 - (38%) Gaps:68/346 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 HHEHHW----GPFFEEPINSAT--SGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSL 268
            |||...    .|.|...||:.|  :|          .||:|.|.|..|....|.|:|.:.:.|..
  Fly    28 HHESSSQLDPDPEFIGFINNVTYPAG----------REAILACSVRNLGKNKVGWLRASDQTVLA 82

  Fly   269 LTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRII 333
            |....||::.  ||.|..|..:.|:|.|:..:..|.|.||||::|.|.:.....:.|..||..|.
  Fly    83 LQGRVVTHNA--RISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIIN 145

  Fly   334 DEHERDVGDRYYKSGSTVDLQCQIS-----RSFFQKERQTILKSTDSANDAVQKLINETTSELNL 393
            :|...|:.   .:.|....|.|:.:     |..:::|...::......:..:.|:.:...|.|.|
  Fly   146 EESSADLA---VQEGEDATLTCKATGNPQPRVTWRREDGEMILIRKPGSRELMKVESYNGSSLRL 207

  Fly   394 IGNVNQTQHKF---SGQDLEKYFTKFITWAKDEEPLQGMTNRRLSV---SDV------------- 439
            :....:....:   :..|:....:|.::.:....|:....::.|..   |||             
  Fly   208 LRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQLLGTPLGSDVQLECQVEASPSPV 272

  Fly   440 --WLT-SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGH 501
              ||. :|.|.|.|.:|.:...|.|.|       ...:|.|.     ::.|..|.:.|...||  
  Fly   273 SYWLKGARTSNGFASVSTASLESGSPG-------PEMLLDGP-----KYGITERRDGYRGVML-- 323

  Fly   502 LLVLIF------LFTCLKTEN 516
            |:|..|      .:.|:.|.:
  Fly   324 LVVRSFSPSDVGTYHCVSTNS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 27/82 (33%)
Ig <258..326 CDD:299845 21/67 (31%)
IGc2 <417..461 CDD:197706 13/62 (21%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 31/103 (30%)
Ig 47..129 CDD:299845 30/93 (32%)
Ig 140..238 CDD:299845 16/100 (16%)
IG_like 247..355 CDD:214653 26/112 (23%)
Ig 256..351 CDD:299845 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.