DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr17

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:536 Identity:120/536 - (22%)
Similarity:198/536 - (36%) Gaps:133/536 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RTLSPASNAAQTLPLSYNSQTSLSLLRLLTIALVIGSQVQVLYTTSVETKSPSASEQSRNGENRS 72
            |.:|.|..|.:.:..|.::|..|:     |.|.|..::.|   |.|..|::.:|:..:       
  Fly   210 RGMSSADGAGEAIATSQSAQIGLT-----TQATVRQTEAQ---TASTATQAAAATSAA------- 259

  Fly    73 LLFDDYNKTKSTLSTADYLSATRA-----TLYAFSSQDQDEDHSQMPIEA-----SNAPHSPIPT 127
                    |.:.:::|...:.|.|     |:|. :|.:.|..:|...:|.     :||.|..:|.
  Fly   260 --------TSAAIASAAAATETAAEMLISTIYP-ASTETDLHNSIERVEGQRGKMANAFHPGVPD 315

  Fly   128 KMSRG-KIPMETPGSMEFSSNSLP----IKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDST 187
            .:::| .||...|....|::..||    ..:.....:|........|.|....:..||..     
  Fly   316 SLTKGFSIPTFLPPFPVFAAADLPAYRAAADAAEAAKLAAEAAAQAAAAKTSSEAVTMSP----- 375

  Fly   188 RTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHL-FTEAVLN------ 245
                          .|:.|...:.:|.:.....:      .||...|||.. .|..|||      
  Fly   376 --------------EEQRRQMFNEQHSYLAAHRD------GGDGAGSAVRRNLTMPVLNITAQMG 420

  Fly   246 ------CRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQ--YPNNWRLLINPTQTE 302
                  |::..|.||.|.|||.....:  ::|...|:..|.|.:..:|  :...|.|.|...:..
  Fly   421 NHAYMPCQIHRLSDKPVSWVRMRDNHI--ISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS 483

  Fly   303 DAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQ 367
            |||.|.||::|.|......:|.:::|...:|.:.     .|:.|:||.|.|.| |.|......:.
  Fly   484 DAGWYECQMATEPKLSAKVHLQIVKPKTELIGDQ-----SRFVKAGSKVALHC-IVRGTLDPPKY 542

  Fly   368 TI-LKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTN 431
            .| .:.....:|:.::....|..:.|:.|.|...|:......:               ||     
  Fly   543 IIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLII---------------PL----- 587

  Fly   432 RRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPA------AVQHNIGSR 490
                              .:..|||||:|......:|.|.:.||:||..|      |.:...|.|
  Fly   588 ------------------VRKEDSGNYTCQPSNSVSVSVDLHVLSGEYSASAIMSTAARTTKGGR 634

  Fly   491 TEIYS-LAMLGHLLVL 505
            :..:| |.:||.|.:|
  Fly   635 STCHSTLGLLGILGLL 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 28/96 (29%)
Ig <258..326 CDD:299845 20/69 (29%)
IGc2 <417..461 CDD:197706 7/43 (16%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 21/78 (27%)
Ig 415..507 CDD:299845 25/93 (27%)
IG_like 521..612 CDD:214653 25/129 (19%)
IGc2 524..605 CDD:197706 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.