DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and LSAMP

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:314 Identity:69/314 - (21%)
Similarity:111/314 - (35%) Gaps:84/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DNLVSAVHLFTEAVLNCRVGMLKDKT--VMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNW 292
            ||:  .|.....|:|.|   :::||.  |.|:.|:    .::..|:..:|.|||:.::.::...:
Human    39 DNI--TVRQGDTAILRC---VVEDKNSKVAWLNRS----GIIFAGHDKWSLDPRVELEKRHSLEY 94

  Fly   293 RLLINPTQTEDAGVYMCQVST-HPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQ 356
            .|.|......|.|.|.|.|.| |.|:.....|.|..||.  |.....||   ....||.|.|.|.
Human    95 SLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPK--ISNISSDV---TVNEGSNVTLVCM 154

  Fly   357 IS----------------RSF-FQKERQTILKSTDSANDAVQ-KLINETTSELNLIGNVNQ---- 399
            .:                |.| .::|...||..|...:...: |..||.:|     .:|.|    
Human   155 ANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSS-----ADVKQVKVT 214

  Fly   400 -------TQHKFS------------------GQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDV 439
                   |:.|.:                  ..|.|        |.:|:..:.....  |.:...
Human   215 VNYPPTITESKSNEATTGRQASLKCEASAVPAPDFE--------WYRDDTRINSANG--LEIKST 269

  Fly   440 WLTSRISIGDAKLSDSGNYSC----SLGRLFTVIVQVQVLTGELPAAVQHNIGS 489
            ...|.:::.:......|||:|    .||.....:|..:.:...:|..:| .||:
Human   270 EGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTIPHPIQ-EIGT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/85 (28%)
Ig <258..326 CDD:299845 18/68 (26%)
IGc2 <417..461 CDD:197706 8/47 (17%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 27/97 (28%)
Ig 132..215 CDD:386229 21/92 (23%)
Ig_3 219..294 CDD:372822 12/84 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.