Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094842.1 | Gene: | IGLON5 / 402665 | HGNCID: | 34550 | Length: | 336 | Species: | Homo sapiens |
Alignment Length: | 291 | Identity: | 67/291 - (23%) |
---|---|---|---|
Similarity: | 105/291 - (36%) | Gaps: | 83/291 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 219 FEEPINSAT--SGDNLVSAVHLFTEAVLNCRVGMLKDK---TVMWVRRTAEKVSLLTVGNVTYSG 278
Fly 279 DPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVST-HPPRVFTTNL-TVLEPPLRIIDEHERDVG 341
Fly 342 DRYYKSGSTVDLQC-------------QISRSFFQKERQTILKSTD------------------S 375
Fly 376 ANDAVQKL--------INETTSELNLIGNVNQTQHKFSG---QDLEKYFTKFITWAKDEEPLQGM 429
Fly 430 TNRRLSVSDVWLTSRISIGDAKLSDSGNYSC 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 26/87 (30%) |
Ig | <258..326 | CDD:299845 | 21/69 (30%) | ||
IGc2 | <417..461 | CDD:197706 | 12/44 (27%) | ||
IGLON5 | NP_001094842.1 | Ig | 41..129 | CDD:416386 | 30/107 (28%) |
Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 48..56 | CDD:409353 | 5/17 (29%) | ||
CDR1 | 56..60 | CDD:409353 | 1/7 (14%) | ||
FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 69..79 | CDD:409353 | 3/13 (23%) | ||
Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
FR3 | 80..115 | CDD:409353 | 11/34 (32%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/10 (30%) | ||
FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
Ig_3 | 134..199 | CDD:404760 | 13/70 (19%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 162..170 | CDD:409353 | 1/8 (13%) | ||
Ig strand F | 191..199 | CDD:409353 | 0/7 (0%) | ||
Ig strand G | 202..212 | CDD:409353 | 3/9 (33%) | ||
Ig_3 | 217..295 | CDD:404760 | 17/83 (20%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/11 (9%) | ||
Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 301..304 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |