DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr13

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:476 Identity:101/476 - (21%)
Similarity:176/476 - (36%) Gaps:119/476 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RNGENRSLLFDDYNKTKSTLSTADYLSA-----------------TRATLYAFSSQDQDEDHSQM 113
            :||.    :.|...|..:.:....|::|                 ..||:...:|:......:|.
  Fly    11 KNGR----VLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATMTTPASEPSVRHINQN 71

  Fly   114 PIEASNAPHSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLKVDRS 178
            .|.:.:....|:|......:......||        .|.:..:|:.:...:.||....     :.
  Fly    72 LIMSQSKEGEPVPVPQPYAQSAASAGGS--------SITSFDSTNVIDGQSQPTPTHL-----QE 123

  Fly   179 TMKQPIDSTRTRNHWTASGFARVTERPRSKHHH-------EHHWGPFFEEPINSATSGDNLVSAV 236
            .:.|....:|.:...||..:.....||....:|       |......|..|:...|....:|: .
  Fly   124 AVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVT-T 187

  Fly   237 HLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRI-RVKFQYPNNWRLLINPTQ 300
            .:...|.:.|.|..:.:..|.|:|:  :...|||||..|||.|.|. ....::..:|.|.|...|
  Fly   188 QIGATAHVPCTVHHIGEGVVSWIRK--KDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQ 250

  Fly   301 TEDAGVYMCQVSTHPPRVFTTNLTVLE-------PPLRIIDEHERDVGDRYYKSGSTVDLQCQIS 358
            ..|||||.||||||||.....:|:|:|       ||:            ||...|||:.|||:  
  Fly   251 LRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPI------------RYLTPGSTLRLQCR-- 301

  Fly   359 RSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDE 423
                      ::::|::                                      :::|.|..|.
  Fly   302 ----------VVQNTEA--------------------------------------SEYIFWYHDN 318

  Fly   424 EPLQGMTNRRLSVSDV--WLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQH- 485
            ..:....:|.::||..  :.:|.::|...:...|||::|.........|.|.:..|:.|||:.| 
  Fly   319 RMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHG 383

  Fly   486 NIGSRTEIYSLAMLGHLLVLI 506
            ::|..|:.....:  |::::|
  Fly   384 HVGGSTKTTQSQL--HMIMII 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 34/83 (41%)
Ig <258..326 CDD:299845 30/68 (44%)
IGc2 <417..461 CDD:197706 11/45 (24%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 35/98 (36%)
IG_like 182..262 CDD:214653 28/82 (34%)
IG_like 285..362 CDD:214653 23/138 (17%)
IGc2 292..361 CDD:197706 19/118 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.