DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Dscam2

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:388 Identity:79/388 - (20%)
Similarity:128/388 - (32%) Gaps:116/388 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 GKIPMETPGSME-FSSNSLPIKNVGTTDQLTTVT----MPTTAFASLKVDRSTMKQPIDSTRTRN 191
            |::.:..|..:. |.:|.|.: |:|....||...    :|.|      ::.....:|||.|:   
  Fly   604 GEVTVIVPPKLSPFQTNILQL-NMGDRASLTCSVVKGDLPLT------INWRKDGRPIDPTQ--- 658

  Fly   192 HWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDN------------LVSAVHLFTE--- 241
            |.:.....:.......::....|.|.:.....|||...:|            :|..|....|   
  Fly   659 HMSVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNR 723

  Fly   242 -AVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSG---DPRIRVKFQYPNNWRLLINPTQTE 302
             .:|:|:...:...:::|.:.|..|           ||   :.|.|...:...|..||:...:.:
  Fly   724 HIMLHCQAQGVPTPSIVWKKATGSK-----------SGEYEEVRERPFTKLLGNGSLLLQHVKED 777

  Fly   303 DAGVYMCQ----VSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQ 363
            ..|.|:||    :.|...:|.  .|.|...|  ......|.|   ..|.|.|..|||.:|.    
  Fly   778 REGFYLCQANNGIGTGIGKVI--QLKVNSSP--YFSSTSRSV---MVKKGDTALLQCAVSG---- 831

  Fly   364 KERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKD-EEPLQ 427
                             .|.||                               |.|.:. :..|.
  Fly   832 -----------------DKPIN-------------------------------IVWMRSGKNTLN 848

  Fly   428 GMTNRRLSVSDV----WLTSRISIGDAKLSDSGNYSCSLGRLF---TVIVQVQVLTGELPAAV 483
            ..||.::||...    .:::.:.|.....:|||.|.|....|:   ..:||:||....||.:|
  Fly   849 PSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSV 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 19/89 (21%)
Ig <258..326 CDD:299845 17/74 (23%)
IGc2 <417..461 CDD:197706 12/48 (25%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 1/5 (20%)
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 14/77 (18%)
IG_like 714..802 CDD:214653 21/100 (21%)
Ig 725..802 CDD:299845 19/89 (21%)
Ig 823..894 CDD:143165 21/122 (17%)
FN3 906..1006 CDD:238020 3/6 (50%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.