DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and babos

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:64/167 - (38%) Gaps:28/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 ASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSA 235
            |.:...:|:|..  |..:..:.:...|..:....|::|..:     |...|.||...|    |:.
  Fly    20 AVISYPQSSMDD--DQMQADDDFDYGGEDQSAPSPQTKSPN-----PVASEKINKTLS----VTG 73

  Fly   236 VHLFTEAVLNCRVGM---LKDKTVMWVRRTAEKVSLLTVG-NVTYSGDPRIRVKFQYPNNWRLLI 296
            :. ..:.||.|.||.   ..|..|:|.           .| ||..:|...::..|:...|:.|.|
  Fly    74 IR-GEDVVLKCDVGSNLHSSDVVVLWY-----------FGDNVISNGKNLVQPNFKLDANYDLTI 126

  Fly   297 NPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRII 333
            .....:.||.|:|:| .....|..|.:|:.|..|..|
  Fly   127 LKASPQVAGSYLCKV-LPSGSVVNTKVTIAEHSLDAI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 23/86 (27%)
Ig <258..326 CDD:299845 17/68 (25%)
IGc2 <417..461 CDD:197706
babosNP_001286719.1 ig 70..154 CDD:278476 25/100 (25%)
IG_like 70..154 CDD:214653 25/100 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.