DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Dscam1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:387 Identity:72/387 - (18%)
Similarity:128/387 - (33%) Gaps:137/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GP-FFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGD 279
            || |.:||.|.....::        |.|.:.|:........::|:|...     ..||:|     
  Fly    38 GPVFLKEPTNRIDFSNS--------TGAEIECKASGNPMPEIIWIRSDG-----TAVGDV----- 84

  Fly   280 PRIRVKFQYPNNWRLLINPTQTED------AGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEH-E 337
            |.:|   |..::.:|:..|.:.||      |.||.|........:.:.::.|    ..::.:| |
  Fly    85 PGLR---QISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHV----RAVVSQHYE 142

  Fly   338 RDVGDRYYKSGSTVDLQCQISR---------SFFQKERQTILKSTDSANDAVQKLINETTSELNL 393
            .|:...:...|::..|:|.|..         |:...|::.....|:...    |.:...:.||::
  Fly   143 EDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDG----KYLVLPSGELHI 203

  Fly   394 --IGNVN-------QTQHKFSGQ------------------------------------------ 407
              :|..:       :|:|:.:|:                                          
  Fly   204 REVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGS 268

  Fly   408 -----DLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRIS-------IGDAKLSDSGNYSC 460
                 ..:.|...|..|.|.   ::|.|.::..|    |..|:.       |.||.:.|||.|.|
  Fly   269 VTLMCPAQAYPVPFFRWYKF---IEGTTRKQAVV----LNDRVKQVSGTLIIKDAVVEDSGKYLC 326

  Fly   461 ----SLG--RLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFTCLKTEN 516
                |:|  .:.||:.....|:.::....|.....|..:               |||..|.|
  Fly   327 VVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAV---------------FTCQYTGN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/88 (20%)
Ig <258..326 CDD:299845 16/73 (22%)
IGc2 <417..461 CDD:197706 15/54 (28%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845 25/112 (22%)
IG 57..133 CDD:214652 18/88 (20%)
IG_like 267..343 CDD:214653 21/82 (26%)
Ig 269..340 CDD:143165 19/77 (25%)
IG_like 353..425 CDD:214653 7/36 (19%)
IGc2 361..413 CDD:197706 6/28 (21%)
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.