DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-theta

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:296 Identity:66/296 - (22%)
Similarity:111/296 - (37%) Gaps:63/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR 281
            |.|.|.:.:.|        |.:..||||.|.|..|:...:.|:|  .:..::||:.|...:.:.|
  Fly   130 PKFGELLQNVT--------VPVSREAVLQCVVDNLQTYKIAWLR--VDTQTILTIQNHVITKNHR 184

  Fly   282 IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYK 346
            :.:.......|.|.|...:..|.|.||||::|.|.:.....|.|:.|| .|:|.....  |...:
  Fly   185 MSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPP-DILDYPTST--DMVIR 246

  Fly   347 SGSTVDLQCQISRS-----FFQKERQTILKSTDSANDAVQKLINETTSELNLIG----------- 395
            .||.|.|:|..:.|     .:::|...::...:.|..........|.:::|.:.           
  Fly   247 EGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNG 311

  Fly   396 ---NVNQ-------------TQHKFSGQDL----------EKYFTKFITWAKDEE---PLQGMTN 431
               .|::             .|::..|..|          |.|......|.|::.   |.:....
  Fly   312 IPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVP 376

  Fly   432 RRLSVSDVWLTSRISIGDAKLSDSGNYSC----SLG 463
            .... |...:|.|::|.:..:.|.|.|.|    |||
  Fly   377 ETFE-SGYKITMRLTIYEVDIQDFGAYRCVAKNSLG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/82 (29%)
Ig <258..326 CDD:299845 18/67 (27%)
IGc2 <417..461 CDD:197706 11/50 (22%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 28/102 (27%)
IG_like 137..230 CDD:214653 28/102 (27%)
IG_like 240..324 CDD:214653 12/85 (14%)
IGc2 247..310 CDD:197706 10/62 (16%)
Ig 327..419 CDD:299845 19/86 (22%)
IG_like 343..420 CDD:214653 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.