DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-theta

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:296 Identity:66/296 - (22%)
Similarity:111/296 - (37%) Gaps:63/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR 281
            |.|.|.:.:.|        |.:..||||.|.|..|:...:.|:|  .:..::||:.|...:.:.|
  Fly   130 PKFGELLQNVT--------VPVSREAVLQCVVDNLQTYKIAWLR--VDTQTILTIQNHVITKNHR 184

  Fly   282 IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYK 346
            :.:.......|.|.|...:..|.|.||||::|.|.:.....|.|:.|| .|:|.....  |...:
  Fly   185 MSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPP-DILDYPTST--DMVIR 246

  Fly   347 SGSTVDLQCQISRS-----FFQKERQTILKSTDSANDAVQKLINETTSELNLIG----------- 395
            .||.|.|:|..:.|     .:::|...::...:.|..........|.:::|.:.           
  Fly   247 EGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNG 311

  Fly   396 ---NVNQ-------------TQHKFSGQDL----------EKYFTKFITWAKDEE---PLQGMTN 431
               .|::             .|::..|..|          |.|......|.|::.   |.:....
  Fly   312 IPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVP 376

  Fly   432 RRLSVSDVWLTSRISIGDAKLSDSGNYSC----SLG 463
            .... |...:|.|::|.:..:.|.|.|.|    |||
  Fly   377 ETFE-SGYKITMRLTIYEVDIQDFGAYRCVAKNSLG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/82 (29%)
Ig strand B 242..246 CDD:409433 3/3 (100%)
Ig strand C 255..264 CDD:409433 2/8 (25%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 3/4 (75%)
Ig <417..474 CDD:472250 14/54 (26%)
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 28/102 (27%)
Ig strand B 147..151 CDD:409353 3/3 (100%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 15/94 (16%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 0/3 (0%)
Ig strand F 303..308 CDD:409275 0/4 (0%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 16/81 (20%)

Return to query results.
Submit another query.