DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-eta

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:144 Identity:41/144 - (28%)
Similarity:63/144 - (43%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR 281
            |.|..||.:.|:        .:..:|.|.|.|..|....|.|:|  .:..::||:.|...:.:.|
  Fly    43 PKFSSPIVNMTA--------PVGRDAFLTCVVQDLGPYKVAWLR--VDTQTILTIQNHVITKNQR 97

  Fly   282 IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYK 346
            |.:.......|.:.|...:..|.|.||||::|.|.:.....|.|:.|| .|:|.....  |...:
  Fly    98 IGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPP-DILDYPTST--DMVVR 159

  Fly   347 SGSTVDLQCQISRS 360
            .||.|.|:|..:.|
  Fly   160 EGSNVTLKCAATGS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/82 (29%)
Ig <258..326 CDD:299845 18/67 (27%)
IGc2 <417..461 CDD:197706
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 25/99 (25%)
IG_like 51..137 CDD:214653 24/95 (25%)
IG_like 153..237 CDD:214653 7/23 (30%)
Ig 161..224 CDD:299845 6/13 (46%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.