DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and fipi

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:252 Identity:46/252 - (18%)
Similarity:82/252 - (32%) Gaps:105/252 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 SGDPRIRVKFQYP-------NNWRLLINPTQTE------------DAGVYMCQV---STHPPR-- 317
            |.||::.:.::.|       :..|:.|..|.||            |.|.:.|:.   |.|...  
  Fly    48 SPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFD 112

  Fly   318 -------VFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDS 375
                   .||.|.||:.                 .|.|....:.|::     :.|.|.       
  Fly   113 LIVYQKITFTENATVMT-----------------VKEGEKATILCEV-----KGEPQP------- 148

  Fly   376 ANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVW 440
                                  |.|.| |:||.:.       ..|.|:...:       .::|..
  Fly   149 ----------------------NVTWH-FNGQPIS-------AGAADDSKFR-------ILADGL 176

  Fly   441 LTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHN-IGSRTEIYSL 496
            |.::::     .:|:|.|:|...::.::...:|..|  :...::|. |.|:|...||
  Fly   177 LINKVT-----QNDTGEYACRAYQVNSIASDMQERT--VLMKIEHKPIWSKTPFVSL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 17/78 (22%)
Ig <258..326 CDD:299845 18/79 (23%)
IGc2 <417..461 CDD:197706 7/43 (16%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/66 (21%)
I-set 128..202 CDD:254352 19/144 (13%)
Ig 133..>193 CDD:299845 18/113 (16%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.