DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and bdl

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:409 Identity:79/409 - (19%)
Similarity:139/409 - (33%) Gaps:140/409 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 FARVTERPRSKHHHEHHWGPFFEEPINS-ATSGDNLVSAV------------------HLFTEAV 243
            ||:|         .|:|.|.:...|.|. .|.|.:.|.:|                  .|...|.
  Fly   305 FAKV---------DENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAE 360

  Fly   244 LNC----RVGMLKDKTVMWVRR-----TAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPT 299
            |.|    |.|..: .:::|.|:     .|::.| |:.||:|.:|                |:.  
  Fly   361 LPCEAIDRDGNNR-PSIIWGRKDGQPLPADRFS-LSGGNLTITG----------------LVE-- 405

  Fly   300 QTEDAGVYMC------------------QVSTHPPRVFTTNLT---------------------- 324
              .|.|:|.|                  .::...|...|.|.|                      
  Fly   406 --GDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPGYLRPNLEYTVW 468

  Fly   325 --VLEPP----LRIIDEHERDVGDRYYKSGSTVDL----QCQISRSFFQKE--RQTI---LKSTD 374
              ::|.|    ||::|:...:...::.:.|...:.    |.:.....|.|:  .||:   :::.|
  Fly   469 YRLMEAPEWRTLRVLDKKVMEATVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADD 533

  Fly   375 SANDAVQKLINETTSELNLIG---NVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSV 436
            .....:|..:.:.|:....:|   |:....::...         .:.|   |.|:||:...||..
  Fly   534 FDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGW---------LLHW---EHPVQGLEGLRLYA 586

  Fly   437 SDVWL-TSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVL---TGELPAAVQH----NIGSRTEI 493
            ...|. .....||.|:..|  ||..........:.:||||   |....:...|    ::.|:.::
  Fly   587 VRWWKEPEHFLIGHAETFD--NYYQLRHLKEDTLFKVQVLAVGTETQQSVPSHELLIDVPSQRKV 649

  Fly   494 YSLAMLGHLLVLIFLFTCL 512
            .:| ::|..:.:|||...|
  Fly   650 RAL-IIGSSVGVIFLLCAL 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 23/133 (17%)
Ig <258..326 CDD:299845 18/114 (16%)
IGc2 <417..461 CDD:197706 14/44 (32%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352
Ig 157..242 CDD:299845
Ig_2 252..337 CDD:290606 12/40 (30%)
IG_like 260..327 CDD:214653 8/30 (27%)
I-set 341..428 CDD:254352 20/108 (19%)
IGc2 356..419 CDD:197706 19/84 (23%)
FN3 435..524 CDD:238020 13/88 (15%)
FN3 554..636 CDD:238020 21/95 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.