DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr2

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:271 Identity:82/271 - (30%)
Similarity:122/271 - (45%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 AVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIR-VKFQYPNNWRLLINPTQTEDAG 305
            |.:||||..|.||:|.|:|:  ..:.:||.|.:||:.|.|.: |:.....:|.|.:...|..|:|
  Fly   124 AAINCRVDNLGDKSVSWIRK--RDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSG 186

  Fly   306 VYMCQVSTHP--PRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQT 368
            :|.|||:|.|  ...|..|:.|..|..:.|.....|:   |.|.||:|.|.|.:      |:..|
  Fly   187 IYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDL---YVKVGSSVTLTCHV------KQPAT 242

  Fly   369 ILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRR 433
                  ||.|               ||.:    :.:.|..:   .|.|:....|    ..:..:|
  Fly   243 ------SAQD---------------IGPI----YWYRGPYI---LTPFVAHPND----AAIDLQR 275

  Fly   434 LSVSDVW---LTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYS 495
            :|:....   |.||:.|.:|:|.|:|||:|.........|.|.|:..|.|||:|.:...||   |
  Fly   276 ISMESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRT---S 337

  Fly   496 LAMLGHLLVLI 506
            .:|....|||:
  Fly   338 GSMRSSRLVLL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 32/85 (38%)
Ig <258..326 CDD:299845 23/70 (33%)
IGc2 <417..461 CDD:197706 13/46 (28%)
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 31/83 (37%)
Ig 116..192 CDD:299845 26/69 (38%)
ig 220..306 CDD:278476 31/126 (25%)
IG_like 220..306 CDD:214653 31/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.