DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and CG33543

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:395 Identity:72/395 - (18%)
Similarity:121/395 - (30%) Gaps:151/395 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PHSPIPTKMSRGKIPMETPGSMEFSSNSLPI------KNVGT------------TDQLTTVTMPT 167
            |..|:..:.|       ||....|.:.|..|      |::.|            |.....:...|
  Fly    44 PTPPLSLQPS-------TPSITHFVNESFIIFCQTVQKDIDTKWRDPRGQTRENTKGRVHIEKKT 101

  Fly   168 TAFASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNL 232
            |...:|..:...::.       |.:||..                          :|...:|:..
  Fly   102 TGLLALVFEHIALED-------RGNWTCE--------------------------VNGNRNGNRN 133

  Fly   233 VSAVHLFT---EAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRL 294
            |:....|.   |.::|.::...|.:.|..||...:     .:.|....|.|...|.:.|...:..
  Fly   134 VNVEREFLASFELLVNQKISFGKTEQVQSVREGRD-----AMVNCFVEGMPAPEVSWLYNGEYIN 193

  Fly   295 LINPTQ--------------TEDAGVYMCQVSTHPPRVFTTN-LTVLEPPLRIIDEHE------R 338
            .:|.|:              ..|||.|.|:.....|....:: :|:|   |||  :|:      .
  Fly   194 TVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMRITPTFSDSDQITIL---LRI--QHKPHWFFNE 253

  Fly   339 DVGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHK 403
            .:..:|...|..|:|.|                      ||:                       
  Fly   254 TLPVQYAYVGGAVNLSC----------------------DAM----------------------- 273

  Fly   404 FSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCS----LGR 464
              |:....:     ||..:.:.:.|. |.|:.|:|...|.::.:.:|  |..|:|.|.    ||.
  Fly   274 --GEPPPSF-----TWLHNNKGIVGF-NHRIFVADYGATLQLQMKNA--SQFGDYKCKVANPLGM 328

  Fly   465 LFTVI 469
            |..||
  Fly   329 LERVI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/97 (19%)
Ig <258..326 CDD:299845 16/82 (20%)
IGc2 <417..461 CDD:197706 12/43 (28%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 12/63 (19%)
IG_like 256..336 CDD:214653 26/133 (20%)
IGc2 263..327 CDD:197706 20/118 (17%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.