DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr4

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:117/282 - (41%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 HHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYS 277
            |:|...:.:|....:|...:.:.|.  ..|:|:|||..|.|:.|.|:|:  ..:.:||||.:||:
  Fly    36 HYWETPYSQPYFDNSSRREVTATVG--QAALLHCRVRNLGDRAVSWIRK--RDLHILTVGILTYT 96

  Fly   278 GDPRIR-VKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVG 341
            .|.|.: :..:..:.|.|.|:..|..|:|.|.|||||.|.......|.|:....:|:...|    
  Fly    97 NDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAE---- 157

  Fly   342 DRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSG 406
             .:.||||.::|.|.                      |:|..:..:                   
  Fly   158 -LFIKSGSDINLTCL----------------------AMQSPVPPS------------------- 180

  Fly   407 QDLEKYFTKFITWAKDEEPLQGMTNRRLSV--SDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVI 469
                     ||.|.|.:..:.......::|  .....||::.|..|..:|||||:||.....:..
  Fly   181 ---------FIYWYKGKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTCSPSSSDSAS 236

  Fly   470 VQVQVLTGELPAAVQHNIGSRT 491
            |.|.|:.||.|||:||...|.|
  Fly   237 VVVHVINGEHPAAMQHGNSSAT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 32/83 (39%)
Ig <258..326 CDD:299845 24/68 (35%)
IGc2 <417..461 CDD:197706 13/45 (29%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 33/96 (34%)
IG_like 53..145 CDD:214653 33/95 (35%)
ig 153..227 CDD:278476 23/128 (18%)
IG_like 161..>227 CDD:214653 22/115 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.