DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-beta

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:417 Identity:90/417 - (21%)
Similarity:142/417 - (34%) Gaps:149/417 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAVLNCRV-----------GMLKDKTVMWVRRTAEKVSLLT 270
            |.|..|:.:.|....        .:|...|.|           |......|.|::  |:..::|.
  Fly    98 PDFVIPLENVTIAQG--------RDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK--ADAKAILA 152

  Fly   271 VGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDE 335
            :.....:.:.|:.|:....|.|.|.|...:.||||.|||||:|.|.::.|..|.|:.|| .||:|
  Fly   153 IHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPP-DIINE 216

  Fly   336 HERDVGDRYYKSGSTVDLQCQ-------------------ISRS-FFQK--------ERQTILKS 372
            ...  ||.....|.:..|.|:                   |:|: ..||        |..|:.|.
  Fly   217 ETS--GDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKI 279

  Fly   373 TDS--------ANDAVQKLINE----------------------TTSELNLIGNV-------NQT 400
            |.|        |::.|...:::                      ..:::.||.||       |..
  Fly   280 TRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYW 344

  Fly   401 QHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSC----S 461
            |.: :|:         :..|.|...|....|...::..:....|:     :.||.|.|.|    |
  Fly   345 QRE-NGE---------MIIAGDRYALTEKENNMYAIEMILHIKRL-----QSSDFGGYKCISKNS 394

  Fly   462 LG------RLFTV--------------------IVQVQV--------LTGEL---PAAVQHNIGS 489
            :|      ||:.:                    :||...        |.|.|   .|..||....
  Fly   395 IGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDRAPDQHPASG 459

  Fly   490 RTEIY---SLAMLG-HLLVLIFLFTCL 512
            ..::.   ::.::| .||.|:.|||.|
  Fly   460 SDQLLGRGTMRLIGTFLLALLVLFTAL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 27/93 (29%)
Ig <258..326 CDD:299845 22/67 (33%)
IGc2 <417..461 CDD:197706 10/47 (21%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 32/120 (27%)
ig 102..195 CDD:278476 25/102 (25%)
IG_like 219..307 CDD:214653 16/89 (18%)
Ig 221..307 CDD:299845 15/85 (18%)
Ig 311..404 CDD:299845 19/107 (18%)
IG_like 327..405 CDD:214653 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.