DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr8

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:126/298 - (42%) Gaps:67/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 GPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDP 280
            ||.|:     .|.|.|:...|....:  |.|||..|.::||.|||.  ..:.|||||..||:.|.
  Fly    41 GPTFD-----TTIGTNITGLVGKTVK--LTCRVKNLGNRTVSWVRH--RDIHLLTVGRYTYTSDQ 96

  Fly   281 RIRVKFQ-YPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRY 344
            |...... :..:|.|.|...|.:|:|:|.||:||.||...:..|.::||...||...|..:    
  Fly    97 RFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHI---- 157

  Fly   345 YKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDL 409
             ..|||::|.|.:  .|..:...|::.|.:      :::||                        
  Fly   158 -NRGSTINLTCIV--KFAPEPPPTVIWSHN------REIIN------------------------ 189

  Fly   410 EKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQV 474
                        .:.|..|::  .::...|..|||:.:..|...|||.|:|:........|:|.:
  Fly   190 ------------FDSPRGGIS--LVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHI 240

  Fly   475 LTGELPAAVQ-HNIGSRTEIYSLAMLGHLLVLIFLFTC 511
            :.||.|||:. .|.|:.|     |....:|:.:.|.||
  Fly   241 VDGEHPAAMHTGNNGNST-----ASQPPVLLPLVLLTC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 33/83 (40%)
Ig strand B 242..246 CDD:409433 1/3 (33%)
Ig strand C 255..264 CDD:409433 5/8 (63%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 2/4 (50%)
Ig <417..474 CDD:472250 14/56 (25%)
dpr8NP_727781.1 IG_like 51..131 CDD:214653 31/83 (37%)
Ig strand B 60..64 CDD:409353 1/5 (20%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 23/127 (18%)

Return to query results.
Submit another query.