DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Dscaml1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:429 Identity:75/429 - (17%)
Similarity:133/429 - (31%) Gaps:140/429 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LYTTSVETKSPSA-----SEQSRNGENRSLLFDDYNKTKSTLSTADYLSATRATLYAFSSQDQDE 108
            ||.:.|:.:...:     ::...:||.|       ....:.||..|...:....|..|.||:...
  Rat   240 LYISDVQKEDALSTYRCITQHKYSGETR-------QSNGARLSVTDPAESIPTILDGFHSQEVWT 297

  Fly   109 DHS-QMPIEASNAPHSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFAS 172
            .|: ::|..||..|...|........:|.::..:...:  .|.|.::.|.|..|.:...|..|.|
  Rat   298 GHAVELPCAASGYPIPAIRWLKDGRPLPADSRWAKRIT--GLTISDLRTEDSGTYICEVTNTFGS 360

  Fly   173 LKVDRSTMKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVH 237
            .:                    |:|...|.                  :|::...:...|.:.:.
  Rat   361 AE--------------------ANGVLTVI------------------DPLHVTLTPKKLKTGIG 387

  Fly   238 LFTEAVLNCRVGMLKDKTVMWVRRT-----AEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLIN 297
              :..:|:|.:....:.|:.|.|.|     .|.:|:..:.|.|                  |||:
  Rat   388 --STVILSCALTGSPEFTIRWYRNTELVLPGEAISIRGLSNET------------------LLIS 432

  Fly   298 PTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPL-RIIDEHERDVGDRYYKSGSTVDLQCQISRSF 361
            ..|...:|.|.|..:..........:.|||... ||:.    ...::....|....|.|      
  Rat   433 SAQKSHSGAYQCFATRKAQTAQDFAIIVLEDGTPRIVS----SFSEKVVNPGEQFSLMC------ 487

  Fly   362 FQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPL 426
                         :|..|....                                 :|||.|:||:
  Rat   488 -------------AAKGAPPPT---------------------------------VTWALDDEPV 506

  Fly   427 ----QGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCS 461
                ...|| :.::||....|.:::...::.|.|.|.|:
  Rat   507 VRDGSHRTN-QYTMSDGTTISHMNVTGPQIRDGGVYRCT 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 17/87 (20%)
Ig <258..326 CDD:299845 14/72 (19%)
IGc2 <417..461 CDD:197706 14/47 (30%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845 7/42 (17%)
IG_like 195..276 CDD:214653 7/42 (17%)
I-set 291..369 CDD:254352 19/99 (19%)
IGc2 298..359 CDD:197706 13/62 (21%)
IGc2 386..447 CDD:197706 17/80 (21%)
I-set 466..560 CDD:254352 22/136 (16%)
Ig 466..556 CDD:299845 22/136 (16%)
IGc2 577..635 CDD:197706
IG_like 665..744 CDD:214653
Ig 673..739 CDD:143165
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.