DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Kirrel1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:301 Identity:59/301 - (19%)
Similarity:102/301 - (33%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LNCRVGMLKD-KTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVY 307
            |.||....|. .|::|.|...::...:|...:...|.....:.       :|||.||..:...|:
  Rat   173 LTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTIS-------QLLIQPTDLDIGRVF 230

  Fly   308 MC---------------QVSTHPPRVFTTNL---TVLEPPLRII-----DEHERDVGDRYYKSGS 349
            .|               ::..|.|...|.::   ||||.. |:|     ..:...:|.|:.|.|.
  Rat   231 TCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGE-RVIFTCQATANPEILGYRWAKGGF 294

  Fly   350 TVD------LQCQISRSFFQKERQ-TILKSTDSANDAVQKLIN------------ETTSELN--- 392
            .::      .:..:..|||.:... .:.....|.|  |..|:|            .||:::.   
  Rat   295 LIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTN--VSTLVNVHFAPRIVVYPKPTTTDIGSDV 357

  Fly   393 -----LIGNVNQTQHKFSGQDLEKYFTKFITWAKDEE----------PLQGMTNRRLSVSDVWLT 442
                 .:||...|                :||.|.:.          |...::.:.||.|:..|.
  Rat   358 TLTCVWVGNPPLT----------------LTWTKKDSNMGPRLPGSPPEANLSAQVLSNSNQLLL 406

  Fly   443 SRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAV 483
            ..::..||     |.|:|.     .::.::.|...|:|..|
  Rat   407 KSVTQADA-----GTYTCR-----AIVPRIGVAEREVPLYV 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 19/99 (19%)
Ig <258..326 CDD:299845 15/85 (18%)
IGc2 <417..461 CDD:197706 12/53 (23%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352
Ig 57..148 CDD:299845
Ig2_KIRREL3-like 170..251 CDD:143236 16/84 (19%)
I-set 255..336 CDD:254352 18/83 (22%)
Ig_2 259..337 CDD:290606 18/80 (23%)
Ig_2 340..437 CDD:290606 21/122 (17%)
IG_like 346..437 CDD:214653 21/116 (18%)
Ig5_KIRREL3 439..536 CDD:143306
IG_like 451..536 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.