| Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
| Alignment Length: | 332 | Identity: | 75/332 - (22%) |
|---|---|---|---|
| Similarity: | 122/332 - (36%) | Gaps: | 85/332 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 219 FEEPINSAT--SGDNLVSAVHLFTEAVLNCRVGMLKDK---TVMWVRRTAEKVSLLTVGNVTYSG 278
Fly 279 DPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVST-HPPRVFTTNL-TVLEPPLRIIDEHERDVG 341
Fly 342 DRYYKSGSTVDLQC-------------QISRSFFQKERQTILKSTD------------------S 375
Fly 376 ANDAVQKL--------INETTSELNLIGNVNQTQHKFSG---QDLEKYFTKFITWAKDEEPLQGM 429
Fly 430 TNRRLSVSDVWLTSRISIGDAKLSDSGNYSC-SLGRLFTVIVQVQVL-TGELPAAVQHNIGSRTE 492
Fly 493 IYSLAML 499 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 26/87 (30%) |
| Ig | <258..326 | CDD:299845 | 21/69 (30%) | ||
| IGc2 | <417..461 | CDD:197706 | 11/44 (25%) | ||
| Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | 30/107 (28%) |
| Ig strand A' | 41..46 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 48..56 | CDD:409353 | 5/17 (29%) | ||
| CDR1 | 56..60 | CDD:409353 | 1/7 (14%) | ||
| FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 69..79 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 80..115 | CDD:409353 | 11/34 (32%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 116..120 | CDD:409353 | 2/3 (67%) | ||
| Ig strand G | 120..129 | CDD:409353 | 3/10 (30%) | ||
| FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
| Ig strand A | 132..137 | CDD:409353 | 3/4 (75%) | ||
| Ig_3 | 134..199 | CDD:404760 | 13/70 (19%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 0/8 (0%) | ||
| Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C | 163..167 | CDD:409353 | 0/3 (0%) | ||
| Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 178..183 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 191..199 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 217..295 | CDD:404760 | 16/85 (19%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 247..251 | CDD:409353 | 1/11 (9%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||