DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and dpr1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:315 Identity:89/315 - (28%)
Similarity:124/315 - (39%) Gaps:89/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 FEEPIN-SATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRI 282
            |:.|.| :.|.|..          ..|:|||..|.||.|.|:|:  ..:.:||.|..||:.|.|.
  Fly    57 FDVPRNLTVTVGQT----------GFLHCRVERLGDKDVSWIRK--RDLHILTAGGTTYTSDQRF 109

  Fly   283 RVKFQYPN---NWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRY 344
            :|  ..|:   ||.|.|...|..|:|||.||::|.|....:....|:|....|...     .|..
  Fly   110 QV--LRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGP-----SDLM 167

  Fly   345 YKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDL 409
            .|:||.::|.|:|.:...:                              :||             
  Fly   168 VKTGSDINLTCKIMQGPHE------------------------------LGN------------- 189

  Fly   410 EKYFTKFITWAKDEEPLQG-------MTNRRLSVSDVW---LTSRISIGDAKLSDSGNYSCSLGR 464
                   |.|.|..|.|.|       .:..|:.|.|.|   ||||:.|..|...|:|||:|....
  Fly   190 -------IFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTV 247

  Fly   465 LFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFTCLKTENRHF 519
            ..|..|.|.|:.||.|||:|||..|.:..:...:...||.::  ..||    :||
  Fly   248 AKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIV--SCCL----QHF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 32/85 (38%)
Ig <258..326 CDD:299845 24/70 (34%)
IGc2 <417..461 CDD:197706 20/53 (38%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 36/108 (33%)
IG_like 60..150 CDD:214653 36/103 (35%)
IG_like 163..257 CDD:214653 33/148 (22%)
Ig 174..244 CDD:143165 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5499
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.