DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Lsamp

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:336 Identity:75/336 - (22%)
Similarity:112/336 - (33%) Gaps:81/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 TERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKT--VMWVRRTAE 264
            ||....|...|....|......|..|  ||:  .|.....|:|.|   :::||.  |.|:.|:  
Mouse    44 TEETMRKKAKEEEGLPVRSVDFNRGT--DNI--TVRQGDTAILRC---VVEDKNSKVAWLNRS-- 99

  Fly   265 KVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVST-HPPRVFTTNLTVLEP 328
              .::..|:..:|.|||:.::.::...:.|.|......|.|.|.|.|.| |.|:.....|.|..|
Mouse   100 --GIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVP 162

  Fly   329 PLRIIDEHERDVGDRYYKSGSTVDLQCQ----------------ISRSF-FQKERQTILKSTDSA 376
            |.  |.....||   ....||.|.|.|.                :.|.| .::|...||..|...
Mouse   163 PK--ISNISSDV---TVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQ 222

  Fly   377 NDAVQ-KLINETTSELNLIGNVNQ-----------TQHKFS------------------GQDLEK 411
            :...: |..||.:|     .:|.|           |:.|.:                  ..|.| 
Mouse   223 SGKYECKAANEVSS-----ADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFE- 281

  Fly   412 YFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLT 476
                   |.:|:..:.....  |.:......|.:::.:......|||:|.......|.....||.
Mouse   282 -------WYRDDTRINSANG--LEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLF 337

  Fly   477 GELPAAVQHNI 487
            ..:...|.|.|
Mouse   338 KRVLPTVPHPI 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/85 (28%)
Ig <258..326 CDD:299845 18/68 (26%)
IGc2 <417..461 CDD:197706 7/43 (16%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 28/100 (28%)
Ig_3 163..232 CDD:372822 16/73 (22%)
Ig_3 250..325 CDD:372822 12/84 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.