DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and DIP-lambda

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:322 Identity:73/322 - (22%)
Similarity:130/322 - (40%) Gaps:76/322 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 HEHHWG------PFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLL 269
            |.|..|      |.|...:::.|        |.:..:....|.|..|....|.|::  ::..::|
  Fly    38 HIHGKGESEEIDPQFLAKLSNTT--------VPIGRDISFTCVVDNLGHYRVAWIK--SDSKAIL 92

  Fly   270 TVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPLRIID 334
            .:.....|.:||:.|.....|.|:|.|:..|..|:|.|||||:|.|.:..:..|.|:.|| .|::
  Fly    93 GIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPP-DILN 156

  Fly   335 EHERDVGDRYYKSGSTVDLQCQIS-----RSFFQKE--RQTILKSTDSANDAVQK--------LI 384
            ..|.:..|...:.|.::.|.|.::     :..:::|  ::.||: ||..:....|        |.
  Fly   157 HPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILR-TDGRDKTGFKSVEGERLVLT 220

  Fly   385 NETTSEL-------------------NLIGNVNQTQHKFS---GQDLEK---------YFTKFIT 418
            |...|::                   |:..|.:.|....|   |..:|:         .|.|.:.
  Fly   221 NVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLN 285

  Fly   419 -WAKDEEPLQGMTNRRLSVSD------VWLTSRISIGDAKLSDSGNYSCS----LGRLFTVI 469
             |.:.|..::.....:.::|:      .|..: ::|.....||.|.||||    ||:..::|
  Fly   286 GWYRSEGNIKLHNGNKYNISEEVINIYTWHLN-LTIRHLTKSDFGTYSCSSVNALGKSESLI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 25/82 (30%)
Ig strand B 242..246 CDD:409433 0/3 (0%)
Ig strand C 255..264 CDD:409433 2/8 (25%)
Ig strand E 292..296 CDD:409433 2/3 (67%)
Ig strand F 306..311 CDD:409433 3/4 (75%)
Ig <417..474 CDD:472250 15/64 (23%)
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 28/102 (27%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 2/3 (67%)
Ig strand F 129..134 CDD:409353 3/4 (75%)
Ig 153..250 CDD:472250 16/97 (16%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 1/14 (7%)
Ig strand F 229..234 CDD:409353 0/4 (0%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 17/77 (22%)
Ig strand B 271..275 CDD:409353 0/3 (0%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 1/12 (8%)
Ig strand F 330..335 CDD:409353 3/4 (75%)

Return to query results.
Submit another query.