DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and NEGR1

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:325 Identity:73/325 - (22%)
Similarity:121/325 - (37%) Gaps:67/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DNLVSAVHLFTEAVLNCRVGMLKD--KTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNW 292
            ||::  |.....|||.|   .|:|  ....|:.|:    |::..|...:|.|||:.:......::
Human    46 DNMM--VRKGDTAVLRC---YLEDGASKGAWLNRS----SIIFAGGDKWSVDPRVSISTLNKRDY 101

  Fly   293 RLLINPTQTEDAGVYMCQVST-HPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQC- 355
            .|.|......|.|.|.|.|.| |.||....:|||..|| :|.|..    .|.....|:.|.|.| 
Human   102 SLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPP-KIYDIS----NDMTVNEGTNVTLTCL 161

  Fly   356 ------------QISRSFFQKERQTILK----STDSANDAVQKLINETT----SELNLIGNVNQT 400
                        .||.|....|....|.    :.|.|.:......|:.:    .::.::.|...|
Human   162 ATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPT 226

  Fly   401 QHKFSGQDLEKYFTKFI------------TWAKDEEPL----QGMTNRRLSVSDVWLTSRISIGD 449
            ..:.....:....:..|            .|.|.|:.|    ||:..:..|...:     :::.:
Human   227 IQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSI-----LTVTN 286

  Fly   450 AKLSDSGNYSC-SLGRLFTVIVQVQVLTGELPAAVQHNI-GSRTEIYSLAMLGHLLVLIFLFTCL 512
            ......|||:| :..:|.|....:.:   ..|:..|:.| ||...::|   ..:|::.:..||.:
Human   287 VTQEHFGNYTCVAANKLGTTNASLPL---NPPSTAQYGITGSADVLFS---CWYLVLTLSSFTSI 345

  Fly   513  512
            Human   346  345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 26/85 (31%)
Ig <258..326 CDD:299845 21/68 (31%)
IGc2 <417..461 CDD:197706 12/60 (20%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 28/96 (29%)
IGc2 152..210 CDD:197706 12/57 (21%)
Ig_3 225..301 CDD:372822 13/80 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.