| Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038936733.1 | Gene: | Ncam1 / 24586 | RGDID: | 67378 | Length: | 1136 | Species: | Rattus norvegicus |
| Alignment Length: | 298 | Identity: | 61/298 - (20%) |
|---|---|---|---|
| Similarity: | 108/298 - (36%) | Gaps: | 77/298 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 246 CRV-GMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMC 309
Fly 310 QVSTH--PPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRS------FFQKER 366
Fly 367 QTILKSTDS----ANDAVQ----KLINETT---------------SELNLIGNVNQT-QHKFS-- 405
Fly 406 ------GQ------DLEKYFTKFITWAKDEEPLQGM---TNRRLSVSDVWLTSRISIGDAKLSDS 455
Fly 456 GNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEI 493 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 23/81 (28%) |
| Ig | <258..326 | CDD:299845 | 17/69 (25%) | ||
| IGc2 | <417..461 | CDD:197706 | 10/46 (22%) | ||
| Ncam1 | XP_038936733.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | 23/83 (28%) |
| Ig strand B | 37..41 | CDD:409451 | 61/298 (20%) | ||
| Ig strand C | 51..55 | CDD:409451 | 0/3 (0%) | ||
| Ig strand E | 79..83 | CDD:409451 | 1/3 (33%) | ||
| Ig strand F | 93..98 | CDD:409451 | 2/4 (50%) | ||
| Ig strand G | 107..110 | CDD:409451 | 0/2 (0%) | ||
| IG_like | 124..190 | CDD:214653 | 14/65 (22%) | ||
| Ig strand B | 135..139 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 148..152 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 172..176 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 186..191 | CDD:409353 | 1/4 (25%) | ||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 20/109 (18%) | ||
| Ig strand B | 231..235 | CDD:143207 | 0/3 (0%) | ||
| Ig strand C | 244..248 | CDD:143207 | 0/3 (0%) | ||
| Ig strand E | 271..275 | CDD:143207 | 1/3 (33%) | ||
| Ig strand F | 285..290 | CDD:143207 | 2/14 (14%) | ||
| Ig strand G | 298..301 | CDD:143207 | 1/2 (50%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 1/5 (20%) | ||
| Ig strand B | 326..330 | CDD:143277 | |||
| Ig strand C | 339..343 | CDD:143277 | |||
| Ig strand E | 379..383 | CDD:143277 | |||
| Ig strand F | 393..398 | CDD:143277 | |||
| Ig strand G | 406..409 | CDD:143277 | |||
| Ig_3 | 422..494 | CDD:404760 | |||
| Ig strand B | 433..437 | CDD:409353 | |||
| Ig strand C | 446..450 | CDD:409353 | |||
| Ig strand E | 473..477 | CDD:409353 | |||
| Ig strand F | 487..492 | CDD:409353 | |||
| FN3 | 509..606 | CDD:238020 | |||
| fn3 | 619..701 | CDD:394996 | |||
| Herpes_BLLF1 | <842..1133 | CDD:282904 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||