Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001344522.1 | Gene: | Ntm / 235106 | MGIID: | 2446259 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 321 | Identity: | 65/321 - (20%) |
---|---|---|---|
Similarity: | 114/321 - (35%) | Gaps: | 96/321 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 206 RSKHHHEHHWGPF--------FE-EPINSATSG-----DNLVSAVHLFTEAVLNCRVGMLKDKTV 256
Fly 257 MWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTE-----------DAGVYMCQ 310
Fly 311 VST-HPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQIS---------RSFFQK- 364
Fly 365 ----------ERQTILK------STDSANDAVQKLINETTSELNL-------------IGNVNQT 400
Fly 401 QHKFSGQDLEKYFTKFITWAKDEEPL-QGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSC 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 24/94 (26%) |
Ig | <258..326 | CDD:299845 | 20/79 (25%) | ||
IGc2 | <417..461 | CDD:197706 | 12/45 (27%) | ||
Ntm | NP_001344522.1 | Ig | 44..132 | CDD:416386 | 26/105 (25%) |
Ig strand A' | 44..49 | CDD:409353 | 2/6 (33%) | ||
Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 59..63 | CDD:409353 | 0/4 (0%) | ||
FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 71..83 | CDD:409353 | 4/15 (27%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/7 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 11/44 (25%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/17 (12%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 2/8 (25%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 12/73 (16%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/6 (17%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 197..205 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 222..299 | CDD:404760 | 15/81 (19%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 239..243 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/8 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 292..297 | CDD:409353 | 3/4 (75%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |