DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and zig-3

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:179 Identity:36/179 - (20%)
Similarity:55/179 - (30%) Gaps:85/179 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 MCQVSTHP--------------PRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQIS 358
            :..:|.||              ..:.:|:||. :|.|:||:..|    |....:|.:|.|:|.: 
 Worm     9 LAAISAHPLSSGEMRAAVSNLVREIDSTHLTT-KPSLKIIEGLE----DNTVSTGESVTLRCDV- 67

  Fly   359 RSFFQKERQTILKSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDE 423
                        .||.                                       |..|.|.||.
 Worm    68 ------------LSTP---------------------------------------TGVIYWEKDG 81

  Fly   424 EPLQGMTNRRLSVSDVWL------------TSRISIGDAKLSDSGNYSC 460
            :.:||  ::.|:|.:..|            ||...|..|.|...|:|.|
 Worm    82 QRIQG--DKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKC 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 5/30 (17%)
Ig <258..326 CDD:299845 6/31 (19%)
IGc2 <417..461 CDD:197706 17/56 (30%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 28/142 (20%)
Ig 61..142 CDD:143165 23/122 (19%)
IG_like 177..244 CDD:214653
Ig <191..237 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.