DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and zig-2

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:275 Identity:50/275 - (18%)
Similarity:85/275 - (30%) Gaps:78/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DYNKTKSTLSTADYLSATRATLYAFSSQDQDEDHSQMPIEASNAPHSPIPTKMSRGKIPMETPGS 141
            |:.|....|.:...|..||      :..|.:....:..:.:..|..:|:|              |
 Worm    19 DHQKPIRALDSQPLLKFTR------TPNDSNVTFGEKFVLSCGANGAPLP--------------S 63

  Fly   142 MEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWTASGFARVTERPR 206
            :.:..|.:.|:...|::....:.......::..:..|..:.|..:.|     .:..:..:.:...
 Worm    64 IYWELNGMRIQGEETSNVYENILNDGKQVSNAAMVSSHYRIPCATAR-----NSGAYKCIIDNGL 123

  Fly   207 SKHHH---------------EHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTV 256
            :|..|               ..:..||....::......|  :||      .|:||    .:...
 Worm   124 TKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEISN--NAV------ALSCR----SETAT 176

  Fly   257 MWVRRTAEKVSLLTVGNVTY----SGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPR 317
            .|.....|:  |||.....|    |||              |:|......|.|.|.|....|   
 Worm   177 EWSWHKGEQ--LLTNDGERYQMFPSGD--------------LIIRNISWSDMGEYNCTARNH--- 222

  Fly   318 VF--TTNLTVLEPPL 330
             |  ||.:|.|.|.|
 Worm   223 -FGETTAITFLYPTL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 22/88 (25%)
Ig <258..326 CDD:299845 20/73 (27%)
IGc2 <417..461 CDD:197706
zig-2NP_510069.1 I-set 34..134 CDD:254352 15/124 (12%)
Ig 34..121 CDD:299845 13/111 (12%)
Ig <179..232 CDD:299845 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.