DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and igcm-2

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:273 Identity:51/273 - (18%)
Similarity:90/273 - (32%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYM 308
            |.|.:.:..:::.....|...::.|...|.......|.::.:........:.|:.....|||||.
 Worm    33 LPCSISLFNEESFSLDWRKDGQLILSAFGQEQGHVTPTLQGRLARDGFLGITIHSVTDGDAGVYQ 97

  Fly   309 CQVS------THPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRS-----FF 362
            |.|:      |.|.:..:..|.|..||:.|.......:   :.|.|:.:..:|:...:     .:
 Worm    98 CIVTKFSKQPTRPEKGLSAKLVVNVPPVIISPSKNAII---HKKVGADLIFECKAEGAPSPEITW 159

  Fly   363 QKERQTILKSTDSANDAVQKLIN--------ETTSELNLIGNVNQTQHKFSGQDLEKYFTK---- 415
            .:..|.|      :...|..|.|        .|...:|:.||        |...::..|||    
 Worm   160 SRNEQII------STSPVLTLSNLEEGDKGLYTCLAVNIEGN--------STSSIDVRFTKATIL 210

  Fly   416 ----------------------------FITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKL 452
                                        ..:|..:::|::        .:.:.|.|.|..||..|
 Worm   211 DLIPLNKTVIEGSNVFWHCHANAQATAISYSWLFEKKPIK--------TTSLGLRSNIRSGDLSL 267

  Fly   453 -----SDSGNYSC 460
                 ||||.|:|
 Worm   268 QDVRKSDSGWYTC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 17/86 (20%)
Ig <258..326 CDD:299845 15/73 (21%)
IGc2 <417..461 CDD:197706 14/49 (29%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 13/67 (19%)
Ig 124..200 CDD:386229 15/92 (16%)
IG_like 214..298 CDD:214653 14/75 (19%)
Ig_3 309..371 CDD:372822
Ig 389..467 CDD:386229
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.