Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362087.1 | Gene: | igcm-2 / 180913 | WormBaseID: | WBGene00020130 | Length: | 802 | Species: | Caenorhabditis elegans |
Alignment Length: | 273 | Identity: | 51/273 - (18%) |
---|---|---|---|
Similarity: | 90/273 - (32%) | Gaps: | 81/273 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 LNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYM 308
Fly 309 CQVS------THPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISRS-----FF 362
Fly 363 QKERQTILKSTDSANDAVQKLIN--------ETTSELNLIGNVNQTQHKFSGQDLEKYFTK---- 415
Fly 416 ----------------------------FITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKL 452
Fly 453 -----SDSGNYSC 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 17/86 (20%) |
Ig | <258..326 | CDD:299845 | 15/73 (21%) | ||
IGc2 | <417..461 | CDD:197706 | 14/49 (29%) | ||
igcm-2 | NP_001362087.1 | IG_like | 23..101 | CDD:214653 | 13/67 (19%) |
Ig | 124..200 | CDD:386229 | 15/92 (16%) | ||
IG_like | 214..298 | CDD:214653 | 14/75 (19%) | ||
Ig_3 | 309..371 | CDD:372822 | |||
Ig | 389..467 | CDD:386229 | |||
FN3 | 476..548 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |