DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and Ncam2

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:286 Identity:65/286 - (22%)
Similarity:104/286 - (36%) Gaps:102/286 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 EAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLL-INPTQTEDA 304
            :|.:.|||.......|.|:....|         ||...|.|..|...  ||.::| ||.:   |.
Mouse   131 DAEVVCRVSSSPAPAVSWLYHNEE---------VTTIPDNRFAVLAN--NNLQILNINKS---DE 181

  Fly   305 GVYMCQ----------------VSTHPPRVF----TTNLTV---------------LEPPL---- 330
            |:|.|:                :...||.:.    :.|.|.               .:|.:    
Mouse   182 GIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDPTISWFR 246

  Fly   331 --RIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQT-ILKSTDSAND-------------A 379
              ::|:|:|     :|...||..:|..   |:...|:..: :.|:|:.|.:             .
Mouse   247 NGKLIEENE-----KYILKGSNTELTV---RNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPH 303

  Fly   380 VQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAK----------DEEPLQGMTNRRL 434
            :.:|.||||||...:..|.:.:    |:.:.:     |||.:          |:.|     :.|:
Mouse   304 ILQLKNETTSENGHVTLVCEAE----GEPVPE-----ITWKRAIDGVMFSEGDKSP-----DGRI 354

  Fly   435 SVSDVWLTSRISIGDAKLSDSGNYSC 460
            .|......|.:.|.|.||||||.|.|
Mouse   355 EVKGQHGRSSLHIRDVKLSDSGRYDC 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 24/103 (23%)
Ig <258..326 CDD:299845 20/103 (19%)
IGc2 <417..461 CDD:197706 18/54 (33%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 21/75 (28%)
IGc2 128..189 CDD:197706 21/71 (30%)
Ig 208..301 CDD:299845 17/100 (17%)
I-set 215..298 CDD:254352 15/90 (17%)
Ig 300..397 CDD:299845 27/95 (28%)
IG_like 308..395 CDD:214653 26/87 (30%)
IG_like 413..491 CDD:214653
IGc2 414..482 CDD:197706
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.