DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and zig-8

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:220 Identity:54/220 - (24%)
Similarity:84/220 - (38%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 AVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGV 306
            |.|:|.|....:..:.|.|  ....:|||.||.|::.|||.:|..:..|.|.|.:...:.:|:|.
 Worm    53 AYLHCSVPPDAEHEIAWTR--VSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGC 115

  Fly   307 YMCQVSTHPPRVFTTNLTVLEPPLRIIDE-HERDVGDRYYKSGSTVDLQCQISRSFFQKERQTIL 370
            |:|:::.....|:...|.||||||..... .::........||..|.|.|.::            
 Worm   116 YLCEINDKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVT------------ 168

  Fly   371 KSTDSANDAVQKLINETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLS 435
             |||...:.:..:.....:.:|.             .|.|||..|              ..|...
 Worm   169 -STDKDEEVLDVVWTRDGNTINF-------------NDTEKYILK--------------VKRDAG 205

  Fly   436 VSDVWLTSRISIGDAKLSDSGNYSC 460
            |    :...:.|..|.:.|.|||:|
 Worm   206 V----VIETMRIRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 25/82 (30%)
Ig <258..326 CDD:299845 21/67 (31%)
IGc2 <417..461 CDD:197706 9/44 (20%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 24/80 (30%)
Ig 55..129 CDD:143165 23/75 (31%)
ig 158..229 CDD:278476 22/113 (19%)
IG_like 158..227 CDD:214653 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.