DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and rig-5

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:173 Identity:42/173 - (24%)
Similarity:67/173 - (38%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PFFEEPINSATSGDNLVSAVHLFTEAV-LNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDP 280
            |..::|        ::.|||.|..:.| ..|.|..|....|.:|:..:.. .||:.....:    
 Worm    84 PTIQQP--------SMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPP-RLLSFDEKVF---- 135

  Fly   281 RIRVKFQYP-------NNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTVLEPPL------RI 332
            |.|.|::..       |.|.|.|...|..|.|.|.||::|.|..:.|..|.|..||:      ..
 Worm   136 RRRNKYELKPRIGDLHNEWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKVPPVVSRSTPAA 200

  Fly   333 IDEHERDVGDRYYKSGSTVDLQCQISRS------FFQKERQTI 369
            ::..|          |:.|.|.|:...:      :.:::||.|
 Worm   201 VEVRE----------GNNVSLTCKADGNPTPTVIWRRQDRQII 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 25/90 (28%)
Ig <258..326 CDD:299845 20/74 (27%)
IGc2 <417..461 CDD:197706
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 30/101 (30%)
Ig_3 191..270 CDD:372822 9/53 (17%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.