Sequence 1: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001192272.1 | Gene: | Papln / 170721 | MGIID: | 2386139 | Length: | 1302 | Species: | Mus musculus |
Alignment Length: | 340 | Identity: | 62/340 - (18%) |
---|---|---|---|
Similarity: | 112/340 - (32%) | Gaps: | 116/340 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 EKVSLLTVGNV--------TYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPP---- 316
Fly 317 -----RVFTTNLTVLE------------------PPLR-----------IIDEHERDVG----DR 343
Fly 344 YY------KSGSTVDLQCQISRSF------FQKERQTILKSTDSANDAVQKLINETTSELNLIGN 396
Fly 397 VNQTQHKFSGQDLEKYFTKF-----------------------------------ITWAKDEEPL 426
Fly 427 QGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVI---VQVQVLTGELPAAVQHNIG 488
Fly 489 ----SRTEIYSLAML 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 19/77 (25%) |
Ig | <258..326 | CDD:299845 | 19/78 (24%) | ||
IGc2 | <417..461 | CDD:197706 | 10/43 (23%) | ||
Papln | NP_001192272.1 | TSP1 | 30..81 | CDD:214559 | |
ADAM_spacer1 | 184..299 | CDD:368694 | |||
TSP1 | 309..362 | CDD:214559 | |||
TSP1 | 389..447 | CDD:214559 | |||
TSP1 | 447..504 | CDD:214559 | |||
TSP1 | 511..562 | CDD:214559 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 563..648 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 694..737 | ||||
Kunitz_BPTI | 771..822 | CDD:333766 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 822..924 | ||||
Papilin_u7 | 831..922 | CDD:374683 | |||
Ig | 932..>995 | CDD:386229 | 14/52 (27%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1024..1064 | 5/39 (13%) | |||
I-set | 1070..1141 | CDD:369462 | 12/75 (16%) | ||
Ig | 1157..1241 | CDD:386229 | 14/87 (16%) | ||
PLAC | 1257..1289 | CDD:370061 | 2/13 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |