DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and LOC103909461

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_021333840.1 Gene:LOC103909461 / 103909461 -ID:- Length:524 Species:Danio rerio


Alignment Length:412 Identity:81/412 - (19%)
Similarity:142/412 - (34%) Gaps:136/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RTLSPASNAAQTLP--LSYNSQTSLSLLRLLTIALV---------IGSQVQVLYTTSVETKSPSA 61
            :::||.|.....||  ||:...|.....:|...||:         :...:.:|....:...|.:.
Zfish    97 QSMSPESVLVLLLPDLLSHQIHTGFLFFQLYAPALLGVSMMMSVRMAPHLTLLILLMIHRISCAD 161

  Fly    62 SEQSRNGENRSLLFDDYNKTKSTLSTADYLSAT-RATLYAFSSQDQD----EDHSQMPIEASNAP 121
            ...:.:..:.:|      |..:.:.:.:|...| ...:..|.::::|    |||..:        
Zfish   162 WGVNYSAPHCAL------KNSTVIMSCNYTYPTGHQIVNVFWTKEKDRKEKEDHPDL-------- 212

  Fly   122 HSPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTTVTMPTTAFASLKVDRSTMKQPIDS 186
                          :|.|   |:|..   ::.:|...:.:|:          ::.:.|.|   |.
Zfish   213 --------------LEDP---EYSQR---LQYLGDEQKYSTI----------RLSQVTKK---DE 244

  Fly   187 TRTRNHWTASGFAR-VTERPRSKHHHEHHWGPF-----------FEEPINSATSGDNLVSAVHLF 239
            .|.        |.| :|.:|..|      |...           .|.| ...|.||::       
Zfish   245 HRY--------FCRIITNKPGGK------WIDVTGVRLSVTDLQLESP-ERVTEGDSV------- 287

  Fly   240 TEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDA 304
             .....|...:....|.:|.|.:.      |:...| :||             :|::...:.|||
Zfish   288 -RLTCRCSCKLTDTPTFIWYRNSH------TLTEET-TGD-------------KLILKSVRREDA 331

  Fly   305 GVYMCQVSTH---PPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQC-------QISR 359
            |.|.|.|:.|   .|.|:   |.|:.|| |.:.....|.|..::.|   |.|.|       .::.
Zfish   332 GRYRCAVNAHTLTSPEVY---LNVMYPP-RNVSVSITDSGQLWFNS---VSLVCISDSNPPALNF 389

  Fly   360 SFFQKERQTILKSTDSANDAVQ 381
            |:| ||.|:....:..:..|||
Zfish   390 SWF-KENQSSAVGSGQSFSAVQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 20/85 (24%)
Ig <258..326 CDD:299845 18/70 (26%)
IGc2 <417..461 CDD:197706
LOC103909461XP_021333840.1 Ig 177..271 CDD:325142 23/148 (16%)
IG_like 277..352 CDD:214653 24/106 (23%)
Ig_2 373..434 CDD:316418 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303091at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.