DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and si:ch211-264f5.6

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_002665524.2 Gene:si:ch211-264f5.6 / 100319064 ZFINID:ZDB-GENE-081104-208 Length:540 Species:Danio rerio


Alignment Length:328 Identity:71/328 - (21%)
Similarity:117/328 - (35%) Gaps:97/328 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 TVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPN-------NWRLLINPTQTEDAGVYMCQVS 312
            ||.|.....:.::::||    ......:.|:..|.|       .::|.:.|...||.|.|:..:.
Zfish    53 TVTWTFNKGQPIAMVTV----IPSSNTVSVRPPYVNRISCNRTTFQLQLGPLVKEDTGEYILTIV 113

  Fly   313 THPPRVFT--TNLTVLEP--PLRIIDEHERDVGDRYYKSGSTVDLQCQISRSFFQKERQTILKST 373
            |:...:.|  .:|.||||  .::|.......|     :..|||.|.|....||..|         
Zfish   114 TNNGDLVTGQIDLEVLEPVTDVKISSNVLEPV-----EFNSTVVLTCSAKGSFTYK--------- 164

  Fly   374 DSANDAVQKLINETTSELNLIGN------VNQTQHK-----------FSGQD------------- 408
             ..|.:|..:::.|..:||.:||      |.:|..:           .||:.             
Zfish   165 -WINGSVPLVVDGTHMQLNAVGNELKISEVRRTDLQGPIVCIAENALESGKSAPFNLTVSYGPEN 228

  Fly   409 -----------LEKYFTKFITWAKDEEP---LQGMTNR-RLSVSDVWLTSRISIGDAKLSDSGNY 458
                       |:|..|..:|...|..|   :|.:.|. .|..:.|...:..::.:.:..:||||
Zfish   229 ILMNQFPTDTYLKKGSTLTLTCTADSNPPATIQWVFNGVNLPSNAVSSPANFTLNNLEEKNSGNY 293

  Fly   459 SC---------SLGRLFTVIVQVQVLTGELPAAVQHNIGSRTEIYSLAMLGHLLVLIFLFTCLKT 514
            :|         .:......:..|:.|:|.       ||.|.|   ||.:.|:..|.:   ||...
Zfish   294 TCVAYNAQTKRYIASRVAFVTVVESLSGT-------NISSST---SLLIAGNSTVNL---TCFAA 345

  Fly   515 ENR 517
            ..|
Zfish   346 AGR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 17/78 (22%)
Ig <258..326 CDD:299845 15/76 (20%)
IGc2 <417..461 CDD:197706 12/56 (21%)
si:ch211-264f5.6XP_002665524.2 Ig 33..129 CDD:299845 17/79 (22%)
IG_like 33..128 CDD:214653 17/78 (22%)
Ig 130..222 CDD:299845 23/106 (22%)
IG_like 149..222 CDD:214653 19/82 (23%)
I-set 233..315 CDD:254352 15/81 (19%)
Ig_2 235..315 CDD:290606 15/79 (19%)
IGc2 335..398 CDD:197706 4/17 (24%)
Ig_2 427..494 CDD:290606
IG_like 427..479 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.