DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and lrit3b

DIOPT Version :9

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:280 Identity:58/280 - (20%)
Similarity:91/280 - (32%) Gaps:112/280 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 NLVSAVHLFTEA----------------VLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGD 279
            |.::|:.||:::                |.:||:..|.|     :.|..|. ||:.:.......:
Zfish   201 NDLTALWLFSDSNQTQRSFVLGLQDNPWVCDCRLSTLLD-----ISRGPES-SLVLLDRFLTCSE 259

  Fly   280 PRIRVKFQYPNNWRLLINPTQTEDAGVYMCQVS---THPPRVFT--TNLTVLEPPLRIIDEHERD 339
            |                    .:.|||....|.   ...|.|.|  |.:|.|             
Zfish   260 P--------------------LDLAGVPFQSVELSRCRRPYVVTSATKITAL------------- 291

  Fly   340 VGDRYYKSGSTVDLQCQISRSFFQKERQTILKSTDSANDAVQKLINETTSELNLI--GNVNQTQH 402
                   .||||.|:|:               :|.....|:..:   .:::.||.  |...||| 
Zfish   292 -------LGSTVLLRCE---------------ATGHPTPALMWI---KSAKRNLYNQGCCKQTQ- 330

  Fly   403 KFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFT 467
              |..|.|::..|...:.: |.|..|:.         |  |.:|:.....||:|.|.|       
Zfish   331 --SSLDTERFPKKLFGYVQ-ESPRVGVR---------W--SVVSLNGISYSDAGEYRC------- 374

  Fly   468 VIVQVQVLTGELPAAVQHNI 487
               :.|.:.|...|.|..|:
Zfish   375 ---RAQNMAGISEAVVSLNV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/103 (17%)
Ig <258..326 CDD:299845 14/72 (19%)
IGc2 <417..461 CDD:197706 10/43 (23%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566 4/12 (33%)
LRR_4 160..201 CDD:289563 58/280 (21%)
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378
leucine-rich repeat 215..230 CDD:275378 0/14 (0%)
Ig 278..391 CDD:299845 39/175 (22%)
I-set 279..391 CDD:254352 39/174 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.