DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr18 and negr1

DIOPT Version :10

Sequence 1:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:354 Identity:80/354 - (22%)
Similarity:116/354 - (32%) Gaps:93/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 DNLVSAVHLFTEAVLNC--RVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNW 292
            ||||  |.....|:|.|  ..|..|.   .|:.|:    |::..|...:|.|||:.:.......:
 Frog    47 DNLV--VRQGETAMLRCFLEEGASKG---AWLNRS----SIIFAGGDKWSVDPRVSIATSSKQEY 102

  Fly   293 RLLINPTQTEDAGVYMCQVST-HPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQC- 355
            .|.|......|.|.|.|.|.| |.||....:|||...| :|.|..    .|.....|:.|.|.| 
 Frog   103 SLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSP-KIYDIS----SDMTVNEGTNVSLICL 162

  Fly   356 ------------QISRSFFQKERQTILK----STDSAND------------AVQKLINETTSELN 392
                        .||.|..|......|.    :.|.|.|            .|:| :..|.:...
 Frog   163 ATGKPEPSISWRHISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDVSFPDVKK-VKVTVNFAP 226

  Fly   393 LIGNVNQTQHKFSGQDLEKYFTKFI-----TWAKDEEPLQGMTN--RRLSVSDVWLTSRISIGDA 450
            .|..:..|........|.:..|..:     .|.|.|:.|   ||  |.:.:.:....|.:::.:.
 Frog   227 TILEITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKL---TNGQRGIRIQNYNTRSILTVSNV 288

  Fly   451 KLSDSGNYSC----SLGRLFTVIVQVQVLTGE---------------------------LPAAVQ 484
            .....|||:|    .||.....:...|::...                           .|:..|
 Frog   289 TEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAKYSVKHYARSSSDKPHYAAPSTAQ 353

  Fly   485 HNIGSRTEI-----YSLAMLGHLLVLIFL 508
            :.|..|.||     |.:..|.....:|:|
 Frog   354 YGITGRAEILFSCWYLVLTLSSFTSIIYL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr18NP_573102.1 IG_like 242..325 CDD:214653 25/85 (29%)
Ig strand B 242..246 CDD:409433 2/3 (67%)
Ig strand C 255..264 CDD:409433 2/8 (25%)
Ig strand E 292..296 CDD:409433 1/3 (33%)
Ig strand F 306..311 CDD:409433 2/4 (50%)
Ig <417..474 CDD:472250 14/67 (21%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 30/97 (31%)
Ig strand B 57..61 CDD:409353 2/3 (67%)
Ig strand C 70..73 CDD:409353 0/5 (0%)
Ig strand E 102..106 CDD:409353 1/3 (33%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
Ig 146..222 CDD:472250 15/80 (19%)
Ig strand B 157..161 CDD:409301 2/3 (67%)
Ig strand C 170..174 CDD:409301 0/3 (0%)
Ig strand E 187..191 CDD:409301 1/3 (33%)
Ig strand F 201..206 CDD:409301 1/4 (25%)
Ig strand G 215..218 CDD:409301 2/3 (67%)
Ig_3 226..302 CDD:464046 16/78 (21%)

Return to query results.
Submit another query.