DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12395 and Spata4

DIOPT Version :10

Sequence 1:NP_573101.1 Gene:CG12395 / 32571 FlyBaseID:FBgn0030722 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_598472.2 Gene:Spata4 / 69281 MGIID:1916531 Length:295 Species:Mus musculus


Alignment Length:187 Identity:41/187 - (21%)
Similarity:81/187 - (43%) Gaps:24/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HIVSGKNLSREELEEVNKWMQQNSIS--TQRLRREFSDVLPLAEIFKRDYPRLVDLFNYPKKSSV 64
            |......|||..|    :|:|...:|  .:.:.|:||:...:||||...||..:.|.::...:|:
Mouse    43 HPPRSSRLSRSVL----RWLQGLDLSFFPRNVTRDFSNGYLVAEIFCIYYPWDLRLSSFENGTSL 103

  Fly    65 QLKLANWETFNFKVLSKLNMTLTKDFMEQMANGVSGAAEVMLHEVIRLEKRQRLAE-QRNAALRQ 128
            ::||.||.... |.|:|....|.|:.:....:..:|..|:::.|:..|...|.:.. |.:.|...
Mouse   104 KVKLDNWAQIE-KFLAKKKFKLPKELIHGTIHCKAGVPEILIQEIYTLLTHQEIRSIQDDLANFT 167

  Fly   129 EQLWE----------------ENDEIKTVVVNKQIGDGIVQVPQKMILYSLYEKVER 169
            :.:::                .|..:..::.|..:....:::...::|..|..|:.|
Mouse   168 DYIYQMRLPLVPRNTVSKSIKNNIRLSELLSNPNVLSNELKIEFLILLQMLQRKLSR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12395NP_573101.1 CH_2 17..106 CDD:461871 25/90 (28%)
Spata4NP_598472.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
CH_2 54..144 CDD:461871 26/94 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..295
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.