DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12395 and Spata4

DIOPT Version :10

Sequence 1:NP_573101.1 Gene:CG12395 / 32571 FlyBaseID:FBgn0030722 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001002852.1 Gene:Spata4 / 306441 RGDID:1303065 Length:323 Species:Rattus norvegicus


Alignment Length:104 Identity:29/104 - (27%)
Similarity:54/104 - (51%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNKWMQQNSIS--TQRLRREFSDVLPLAEIFKRDYPRLVDLFNYPKKSSVQLKLANWETFNFKVL 79
            |.:|:|...:|  .:.:.|:||:...:||||...||..:.|.::...:|:::||.||.... |.|
  Rat    54 VLRWLQGLDLSFFPRNVTRDFSNGYLVAEIFCIYYPWDLRLSSFENGTSLKVKLDNWAQIE-KFL 117

  Fly    80 SKLNMTLTKDFMEQMANGVSGAAEVMLHEVIRLEKRQRL 118
            :|....|.|:.:....:..:|..|:::.|:..|...|.:
  Rat   118 AKKKFKLPKELIHGTIHCKAGVPEILIQEIYTLLTHQEI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12395NP_573101.1 CH_2 17..106 CDD:461871 26/90 (29%)
Spata4NP_001002852.1 CH_2 54..144 CDD:461871 26/90 (29%)

Return to query results.
Submit another query.