DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12698 and KT1

DIOPT Version :10

Sequence 1:NP_573100.1 Gene:CG12698 / 32570 FlyBaseID:FBgn0030721 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_180233.1 Gene:KT1 / 817206 AraportID:AT2G26650 Length:857 Species:Arabidopsis thaliana


Alignment Length:133 Identity:28/133 - (21%)
Similarity:54/133 - (40%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EKSLLRTPHAKRSVDERKKLCTIVANLACFSKFPPKVRARLVPIVKFMAISPGRIVMKEEDFPVT 132
            :::|...|.|.||........:::..:..|......:..:||..:|.....|...|:.:.:.|..
plant   344 QETLDALPKAIRSSISHFLFYSLMDKVYLFRGVSNDLLFQLVSEMKAEYFPPKEDVILQNEAPTD 408

  Fly   133 IYFIIAGEVEMSKNIYKKGSSRPTVQTEAIFGPGDCIGDIDVMEDTPRTNTYIATTYCELLAIFN 197
            .|.::.|..::..  ...|:.....:.:|    ||.||:|.|:...|:..|......|:||.:..
plant   409 FYILVNGTADLVD--VDTGTESIVREVKA----GDIIGEIGVLCYRPQLFTVRTKRLCQLLRMNR 467

  Fly   198 TNY 200
            |.:
plant   468 TTF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12698NP_573100.1 CAP_ED 97..195 CDD:237999 22/97 (23%)
KT1NP_180233.1 PLN03192 26..856 CDD:215625 28/133 (21%)
ANK repeat 522..548 CDD:293786
ANK repeat 550..581 CDD:293786
ANK repeat 583..614 CDD:293786
ANK repeat 647..678 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.