DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vap and RASAL2

DIOPT Version :9

Sequence 1:NP_001285314.1 Gene:vap / 32569 FlyBaseID:FBgn0003969 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_016858338.1 Gene:RASAL2 / 9462 HGNCID:9874 Length:1419 Species:Homo sapiens


Alignment Length:594 Identity:145/594 - (24%)
Similarity:252/594 - (42%) Gaps:113/594 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 KKIKGIKHHGHLNKKSDKTTKWKQLYFALINDGS-------------------ETQLCF---YDN 418
            |::||.........|.|:.|.::.......:|.|                   .|..|.   ...
Human   322 KRLKGSIKRTKSQSKLDRNTSFRLPSLRSTDDRSRGLPKLKESRSHESLLSPCSTVECLDLGRGE 386

  Fly   419 PKKTKPKGLIDLSCAYLYQCHDSLWERPYCFQIVERALPCLATVTYL-------CAPSQESYVEW 476
            |...||             .|.|:..:.:||:           ||||       |..:.|. .:|
Human   387 PVSVKP-------------LHSSILGQDFCFE-----------VTYLSGSKCFSCNSASER-DKW 426

  Fly   477 INSLKAQCDSQLSRAQKKVSRLRELRCLNLHVLEAHRL-PFKLVPHPYCSISLNQVKVGKTRVKI 540
            :.:|:..........::..:.||      |.::||..| |.|..   :|.:.|:.....:|..|.
Human   427 MENLRRTVQPNKDNCRRAENVLR------LWIIEAKDLAPKKKY---FCELCLDDTLFARTTSKT 482

  Fly   541 APEPV-WEEEFVLDDVPPDVVSLTITLI----SRGKRGKDSEVAELTIDLSSLKNGQETEGWYQL 600
            ..:.: |.|.|....:|| :.|:|:.:.    .:.|:.|::.|..:.|..:|:...|..|.||.:
Human   483 KADNIFWGEHFEFFSLPP-LHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYPV 546

  Fly   601 TGMTP-MGEWG--SLRLRMRYLDDLIMPCEEYSPLQQLLLESELYAVKALAELCH-NDRVPLATA 661
            :..|| .|:.|  |:|::.|:....|:|.|:|....:.:..:.......|..:.. .::..||.|
Human   547 STPTPNKGKTGGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACA 611

  Fly   662 LLRVFRQEKRETELIRMLCQAEVTRENETTTL-FRGASLATTLMDLYMRTECSGFLQSAVSETVQ 725
            |:.:.:...|..:.:..|..:||.|..|...| ||..::||..::.|::.....:|..|:.|.::
Human   612 LVHILQSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIK 676

  Fly   726 RILESKQSAELNPTKMDVNDDACTNAEF------LLQILDLVTQSIFTSPDACPRNVRFICSCLQ 784
            .:.||.::.|::|:|       |:::|.      |....:|....|..|....||.:        
Human   677 ALYESDENCEVDPSK-------CSSSELIDHQSNLKMCCELAFCKIINSYCVFPREL-------- 726

  Fly   785 KAVMAKWPTERL------VRTRVVSGFIFLRLLCPALLNPRQFGLVSETPPMAATRSLVMVAKCL 843
            |.|.|.|..:.|      :..|::|..:|||.||||:::|..|.|:.|.|....:|:|.::||.:
Human   727 KEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLTLIAKVI 791

  Fly   844 QNLANLIEFGGKEQYMEVVNPFILKNKERMIVFLDQLSSVNDPNQPLGM--FVEQSTNLNSQDTG 906
            |||||..:||.||:||..:|.|:......|..||.::|:.:..:...|.  ::         |.|
Human   792 QNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPDTISNTPGFDGYI---------DLG 847

  Fly   907 RELATLHHI 915
            |||:.||.:
Human   848 RELSVLHSL 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vapNP_001285314.1 SH2_Nterm_RasGAP 64..166 CDD:198216
SH3_RasGAP 183..241 CDD:212722
SH2_Cterm_RasGAP 252..326 CDD:198217
PH_RASA1 379..484 CDD:270080 24/133 (18%)
C2_Ras_p21A1 499..622 CDD:176045 34/131 (26%)
RasGAP 620..954 CDD:413381 85/312 (27%)
RASAL2XP_016858338.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3508
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D44624at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.